BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10o24 (561 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 23 2.1 DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride... 23 2.1 DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride... 23 2.1 DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride... 23 2.1 DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 22 3.7 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 22 3.7 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 4.9 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 6.4 DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 21 8.5 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 8.5 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 8.5 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 8.5 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 21 8.5 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 23.0 bits (47), Expect = 2.1 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 36 WLRSTKPSRKSVFSGSSLTGELISISSLICPMSNSW 143 W RKS S +SL LI ++ CP+ SW Sbjct: 218 WKNDEGTLRKSP-SLTSLNAYLIKNQTITCPIKVSW 252 >DQ667191-1|ABG75743.1| 475|Apis mellifera pH-sensitive chloride channel variant 3 protein. Length = 475 Score = 23.0 bits (47), Expect = 2.1 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 36 WLRSTKPSRKSVFSGSSLTGELISISSLICPMSNSW 143 W RKS S +SL LI ++ CP+ SW Sbjct: 218 WKNDEGTLRKSP-SLTSLNAYLIKNQTITCPIKVSW 252 >DQ667190-1|ABG75742.1| 509|Apis mellifera pH-sensitive chloride channel variant 1 protein. Length = 509 Score = 23.0 bits (47), Expect = 2.1 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 36 WLRSTKPSRKSVFSGSSLTGELISISSLICPMSNSW 143 W RKS S +SL LI ++ CP+ SW Sbjct: 269 WKNDEGTLRKSP-SLTSLNAYLIKNQTITCPIKVSW 303 >DQ667189-1|ABG75741.1| 458|Apis mellifera pH-sensitive chloride channel protein. Length = 458 Score = 23.0 bits (47), Expect = 2.1 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = +3 Query: 36 WLRSTKPSRKSVFSGSSLTGELISISSLICPMSNSW 143 W RKS S +SL LI ++ CP+ SW Sbjct: 218 WKNDEGTLRKSP-SLTSLNAYLIKNQTITCPIKVSW 252 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 22.2 bits (45), Expect = 3.7 Identities = 7/35 (20%), Positives = 20/35 (57%) Frame = -3 Query: 535 IVISCKFCVTLSLEVVLDALLERNEP*AVCSTDTG 431 IV+ FC+ ++ + + ++ ++ +C T++G Sbjct: 4 IVVIFAFCICVNAMTIEELKIQLHDVQEICKTESG 38 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 22.2 bits (45), Expect = 3.7 Identities = 6/15 (40%), Positives = 10/15 (66%) Frame = -2 Query: 554 CYTSYFYCNLM*VLC 510 C+ +F CN+M +C Sbjct: 631 CWLPFFTCNIMDAIC 645 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/34 (32%), Positives = 19/34 (55%) Frame = +3 Query: 438 SVLHTAQGSFRSSRASKTTSRLSVTQNLHEITIK 539 SVLH+AQ SS ++ T ++T L + ++ Sbjct: 940 SVLHSAQSVVASSASNVTNVTTNLTTILPPVKVQ 973 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 6.4 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +1 Query: 415 CKAR*TRYRCYTQLKVHS 468 CKA + C QLKVH+ Sbjct: 206 CKACGKGFTCSKQLKVHT 223 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 21.0 bits (42), Expect = 8.5 Identities = 10/35 (28%), Positives = 17/35 (48%) Frame = -3 Query: 535 IVISCKFCVTLSLEVVLDALLERNEP*AVCSTDTG 431 IV+ FCV + + + + +VC T+TG Sbjct: 4 IVLIFGFCVCVGALTIEELKTRLHTEQSVCKTETG 38 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 8.5 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = +1 Query: 199 NGIGQEAASRQERGSSE*EARDREDSLEKHDHRSRDGRFNCRHLQRKNF 345 N E R+ R +S+ +RDR++ + +H+ N + N+ Sbjct: 48 NSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNNNY 96 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 8.5 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = +1 Query: 199 NGIGQEAASRQERGSSE*EARDREDSLEKHDHRSRDGRFNCRHLQRKNF 345 N E R+ R +S+ +RDR++ + +H+ N + N+ Sbjct: 48 NSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNNNY 96 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.0 bits (42), Expect = 8.5 Identities = 11/49 (22%), Positives = 22/49 (44%) Frame = +1 Query: 199 NGIGQEAASRQERGSSE*EARDREDSLEKHDHRSRDGRFNCRHLQRKNF 345 N E R+ R +S+ +RDR++ + +H+ N + N+ Sbjct: 48 NSYKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNNNY 96 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.0 bits (42), Expect = 8.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -3 Query: 499 LEVVLDALLERNEP*AVCSTDTGSTVLYRL 410 L V+++ LL VC T ++ LYRL Sbjct: 11 LFVIINVLLHGQVICFVCKDITSTSALYRL 40 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,915 Number of Sequences: 438 Number of extensions: 2500 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -