BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10o21 (663 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr 1|||M... 27 1.8 SPCC594.04c |||steroid oxidoreductase superfamily protein|Schizo... 27 3.2 SPAC4F10.09c |||ribosome biogenesis protein Noc1 |Schizosaccharo... 26 4.2 SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces p... 26 5.6 SPCC1795.08c |||histone acetyltransferase complex subunit |Schiz... 26 5.6 SPCC61.02 |spt3||histone acetyltransferase complex subunit Spt3|... 25 7.4 SPBPB2B2.08 |||conserved fungal protein|Schizosaccharomyces pomb... 25 9.7 >SPAC22G7.04 |ubp13|pan2|poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 1115 Score = 27.5 bits (58), Expect = 1.8 Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +3 Query: 342 LPDGNSWCPDCVEAEP-VVRHYLSELDKSIIFVYVDVGDREYWK 470 LP G WC C+ +P ++R ++ L +F+ V E+WK Sbjct: 688 LPPG--WCEYCLAHQPFLLRSFIRSL-PDCLFINTQVKHHEHWK 728 >SPCC594.04c |||steroid oxidoreductase superfamily protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 338 Score = 26.6 bits (56), Expect = 3.2 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = +1 Query: 82 DYHYMYLMIILPNALYRIFINFSIHNLTVGNLYV 183 DY ++ + I+P +Y +F F IH V +LY+ Sbjct: 133 DYRWVRVRQIMPKWIYPLFHYFYIHIFQVLHLYL 166 >SPAC4F10.09c |||ribosome biogenesis protein Noc1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 860 Score = 26.2 bits (55), Expect = 4.2 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 85 YHYMYLMIILPNALYRIFINFSIHNLTVGNLYVFK 189 +H M+ ++I AL +F N IH+ VFK Sbjct: 493 FHVMHQLVIATTALRSMFTNAEIHDFDGDEEEVFK 527 >SPAC17A2.06c |vps8||WD repeat protein Vps8|Schizosaccharomyces pombe|chr 1|||Manual Length = 1272 Score = 25.8 bits (54), Expect = 5.6 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = -2 Query: 653 NLPLKEXVIFPYLIFFFEQHLQKF 582 ++P+ V FPYL F E+H F Sbjct: 727 DVPVDNSVDFPYLRLFLEKHADDF 750 >SPCC1795.08c |||histone acetyltransferase complex subunit |Schizosaccharomyces pombe|chr 3|||Manual Length = 985 Score = 25.8 bits (54), Expect = 5.6 Identities = 17/63 (26%), Positives = 30/63 (47%) Frame = +2 Query: 458 RILEGQRVPVQNGQSL*VDGHTDFNKMEGSTEA*GKPVQQSGTSADVVRRRRLNKEKSPI 637 ++L Q +P + Q + VD T+ E + + KPV + + + +L EKSP Sbjct: 313 QLLNNQEIPSEQ-QIISVDKATESPVQEVAVDVNEKPVDEIVEPSKLQMENKLPSEKSPT 371 Query: 638 LLR 646 + R Sbjct: 372 IDR 374 >SPCC61.02 |spt3||histone acetyltransferase complex subunit Spt3|Schizosaccharomyces pombe|chr 3|||Manual Length = 307 Score = 25.4 bits (53), Expect = 7.4 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = +3 Query: 501 RSKLMVIPTLIKWKGVQRLEGSQCSNRELLQMLFEEED 614 R+K+ + T + WK V++ Q +N + LFEE D Sbjct: 75 RAKVNRLKTYLSWKEVRKKAKEQDANPADTKDLFEEVD 112 >SPBPB2B2.08 |||conserved fungal protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 220 Score = 25.0 bits (52), Expect = 9.7 Identities = 13/32 (40%), Positives = 18/32 (56%), Gaps = 1/32 (3%) Frame = +3 Query: 375 VEAEPVVRHYLSELDK-SIIFVYVDVGDREYW 467 V+ P RH L+E+DK S + V G +YW Sbjct: 121 VQVSPEARHKLAEIDKGSHLEANVSGGLLKYW 152 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,687,762 Number of Sequences: 5004 Number of extensions: 57367 Number of successful extensions: 140 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 132 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 301829700 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -