BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10o21 (663 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42850.2 68418.m05223 expressed protein 75 6e-14 At5g42850.1 68418.m05222 expressed protein 75 6e-14 At5g04260.1 68418.m00417 thioredoxin family protein low similari... 31 0.52 At5g06690.1 68418.m00756 thioredoxin family protein low similiar... 30 1.2 At3g56420.1 68416.m06275 thioredoxin family protein similar to t... 29 2.1 At3g01460.1 68416.m00070 PHD finger family protein / methyl-CpG ... 29 3.6 At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) i... 29 3.6 At1g52650.1 68414.m05945 F-box family protein contains F-box dom... 28 4.8 At5g03290.1 68418.m00279 isocitrate dehydrogenase, putative / NA... 27 8.4 At3g09810.1 68416.m01169 isocitrate dehydrogenase, putative / NA... 27 8.4 At2g35160.1 68415.m04313 SET domain-containing protein (SUVH5) i... 27 8.4 >At5g42850.2 68418.m05223 expressed protein Length = 134 Score = 74.5 bits (175), Expect = 6e-14 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +3 Query: 300 SRGPPVFFYFSGSKLPD-GNSWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGDREYWKDK 476 SR F F P G SWCPDCV AEPV+ L E + + + GDR W+ Sbjct: 26 SRSKINFILFLADNDPTTGQSWCPDCVRAEPVIYKTLEEFPEEVKLIRAYAGDRPTWRTP 85 Query: 477 ECPFRTDSRSKLMVIPTLIKWKG 545 P+R DSR KL +PTL++W G Sbjct: 86 AHPWRVDSRFKLTGVPTLVRWDG 108 >At5g42850.1 68418.m05222 expressed protein Length = 134 Score = 74.5 bits (175), Expect = 6e-14 Identities = 35/83 (42%), Positives = 44/83 (53%), Gaps = 1/83 (1%) Frame = +3 Query: 300 SRGPPVFFYFSGSKLPD-GNSWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGDREYWKDK 476 SR F F P G SWCPDCV AEPV+ L E + + + GDR W+ Sbjct: 26 SRSKINFILFLADNDPTTGQSWCPDCVRAEPVIYKTLEEFPEEVKLIRAYAGDRPTWRTP 85 Query: 477 ECPFRTDSRSKLMVIPTLIKWKG 545 P+R DSR KL +PTL++W G Sbjct: 86 AHPWRVDSRFKLTGVPTLVRWDG 108 >At5g04260.1 68418.m00417 thioredoxin family protein low similarity to SP|P29429 Thioredoxin. [Aspergillus nidulans] {Emericella nidulans}; contains Pfam profile: PF00085 Thioredoxin Length = 192 Score = 31.5 bits (68), Expect = 0.52 Identities = 17/66 (25%), Positives = 31/66 (46%) Frame = +3 Query: 357 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGDREYWKDKECPFRTDSRSKLMVIPTLIK 536 +WC C+ +P + +E + F +VDV P+R SR+ + +PT+ Sbjct: 108 AWCRKCIYLKPKLEKLAAEFYPRLRFYHVDV--------NAVPYRLVSRAGVTKMPTIQL 159 Query: 537 WKGVQR 554 W+ Q+ Sbjct: 160 WRDGQK 165 >At5g06690.1 68418.m00756 thioredoxin family protein low similiarity to SP|P34723 Thioredoxin {Penicillium chrysogenum}; contains Pfam profile: PF00085 Thioredoxin Length = 210 Score = 30.3 bits (65), Expect = 1.2 Identities = 17/62 (27%), Positives = 26/62 (41%) Frame = +3 Query: 357 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGDREYWKDKECPFRTDSRSKLMVIPTLIK 536 SWC C+ +P + +E + F YVDV + P R + +PT+ Sbjct: 128 SWCRKCIYLKPKLEKLAAEYNNRAKFYYVDV--------NKVPQTLVKRGNISKMPTIQL 179 Query: 537 WK 542 WK Sbjct: 180 WK 181 >At3g56420.1 68416.m06275 thioredoxin family protein similar to thioredoxin [Nicotiana tabacum] GI:20047; contains Pfam profile: PF00085 Thioredoxin Length = 100 Score = 29.5 bits (63), Expect = 2.1 Identities = 15/30 (50%), Positives = 17/30 (56%) Frame = +3 Query: 360 WCPDCVEAEPVVRHYLSELDKSIIFVYVDV 449 WC C + EPV R S S+IFV VDV Sbjct: 19 WCVPCKKIEPVFRDLASRY-PSMIFVTVDV 47 >At3g01460.1 68416.m00070 PHD finger family protein / methyl-CpG binding domain-containing protein contains Pfam profiles PF00628: PHD-finger (2 copies), PF01429: Methyl-CpG binding domain Length = 2176 Score = 28.7 bits (61), Expect = 3.6 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 339 KLPDGNSWCPDCVEAEPVVRHYL 407 ++PDGN +CP CV A+ + + L Sbjct: 1323 RIPDGNWYCPSCVIAKRMAQEAL 1345 >At1g19730.1 68414.m02465 thioredoxin H-type 4 (TRX-H-4) (GREN) identical to SP|Q39239 Thioredoxin H-type 4 (TRX-H-4) {Arabidopsis thaliana} Length = 119 Score = 28.7 bits (61), Expect = 3.6 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = +3 Query: 357 SWCPDCVEAEPVVRHYLSELDKSIIFVYVDVGD 455 SWCP C P+ + S IF VDV + Sbjct: 38 SWCPPCRMIAPIFNDLAKKFMSSAIFFKVDVDE 70 >At1g52650.1 68414.m05945 F-box family protein contains F-box domain Pfam:PF00646 Length = 465 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -2 Query: 203 IFIYFLNTYKLPTVKLCIEKFMKILYRALGKIII 102 IF+ L T L +VKLC++KF AL ++++ Sbjct: 156 IFLPMLKTLVLHSVKLCVDKFFFRALPALEELVL 189 >At5g03290.1 68418.m00279 isocitrate dehydrogenase, putative / NAD+ isocitrate dehydrogenase, putative strong similarity to isocitrate dehydrogenase (NAD+) [Nicotiana tabacum] GI:3021506 Length = 374 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 566 ASLKPLYSLPFY*SRYDHQLRATVR 492 A+++P YSLP Y +RYD T+R Sbjct: 134 ANVRPCYSLPGYKTRYDDVDLITIR 158 >At3g09810.1 68416.m01169 isocitrate dehydrogenase, putative / NAD+ isocitrate dehydrogenase, putative strong similarity to isocitrate dehydrogenase (NAD+) GB:CAA65502 GI:3021506 [Nicotiana tabacum] Length = 374 Score = 27.5 bits (58), Expect = 8.4 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -2 Query: 566 ASLKPLYSLPFY*SRYDHQLRATVR 492 A+++P YSLP Y +RYD T+R Sbjct: 134 ANVRPCYSLPGYKTRYDDVDLITIR 158 >At2g35160.1 68415.m04313 SET domain-containing protein (SUVH5) identical to SUVH5 [Arabidopsis thaliana] GI:13517751; contains Pfam profiles PF00856: SET domain, PF05033: Pre-SET motif, PF02182: YDG/SRA domain; identical to cDNA SUVH5 (SUVH5) GI:13517750 Length = 794 Score = 27.5 bits (58), Expect = 8.4 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -2 Query: 470 LPIFSISNIDIDKNDTFVELTKVMPDDW 387 LPI +++N+D +K F+ K++ DW Sbjct: 551 LPICAVNNLDDEKPPPFIYTAKMIYPDW 578 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,416,660 Number of Sequences: 28952 Number of extensions: 276239 Number of successful extensions: 721 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 720 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1393347168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -