BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10o20 (599 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_25162| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_3371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_41761| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.025) 27 8.8 >SB_25162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 435 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/30 (60%), Positives = 24/30 (80%) Frame = +2 Query: 2 YCEFHRMYKNKEFRKAAQLLISLITSKIAP 91 Y EFHRMY +FR AA LL+SL+TS+++P Sbjct: 310 YREFHRMYAEADFRGAATLLVSLLTSRLSP 339 >SB_3371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1135 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = +3 Query: 249 YLGTWHGLH*PRNLKKVLSDKVLCVL 326 Y+ G+H P ++K+VL+D V C+L Sbjct: 970 YIHVAQGVHLPSHVKEVLTDGVFCLL 995 >SB_41761| Best HMM Match : DNA_pol_B_2 (HMM E-Value=0.025) Length = 1480 Score = 27.5 bits (58), Expect = 8.8 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 377 SVKQQELIENLSSHSFVILHHNFNRFYE 460 SVK ++LI NL++ + ++HH + YE Sbjct: 861 SVKVEKLIPNLNNKTKYVVHHETLKLYE 888 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,352,831 Number of Sequences: 59808 Number of extensions: 251625 Number of successful extensions: 481 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 481 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1451595000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -