BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10o14 (599 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 23 3.0 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 23 3.0 AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alph... 22 4.0 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.3 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 21 7.0 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 7.0 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 7.0 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 21 7.0 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 41 SKQWEELESSLFASQSSYH-HNSRMPNVQIQL*PH 142 S+ W + F+++ H HN MPNV I++ P+ Sbjct: 113 SRVW--MPDLFFSNEKEGHFHNIIMPNVYIRIFPN 145 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.6 bits (46), Expect = 3.0 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 41 SKQWEELESSLFASQSSYH-HNSRMPNVQIQL*PH 142 S+ W + F+++ H HN MPNV I++ P+ Sbjct: 113 SRVW--MPDLFFSNEKEGHFHNIIMPNVYIRIFPN 145 >AM420631-1|CAM06631.1| 153|Apis mellifera bursicon subunit alpha protein precursor protein. Length = 153 Score = 22.2 bits (45), Expect = 4.0 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +1 Query: 463 ECQTQSVIPFEQYP 504 ECQ VI F QYP Sbjct: 28 ECQATPVIHFLQYP 41 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 5.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = -1 Query: 389 ARAISFASILMGQSLAGTILDNGTISRSLGTA 294 ARA+ F S L G++L+ I + GT+ Sbjct: 450 ARAVKFTSKLFGRALSRRIKATVLFATETGTS 481 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 21.4 bits (43), Expect = 7.0 Identities = 10/29 (34%), Positives = 13/29 (44%) Frame = +3 Query: 33 NRSPNNGKN*SHLCLRLNHLIITTVVCPM 119 N S N N LC +NH+ V P+ Sbjct: 90 NYSNYNNNNYKQLCYNINHIEQIPVPVPV 118 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -1 Query: 140 EARAVSGHWAYDCCDDKMIETQTKMTL 60 E AV Y CCD+ ++ +T+ Sbjct: 214 EVPAVRNEKFYTCCDEPYLDITFNITM 240 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -1 Query: 140 EARAVSGHWAYDCCDDKMIETQTKMTL 60 E AV Y CCD+ ++ +T+ Sbjct: 214 EVPAVRNEKFYTCCDEPYLDITFNITM 240 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 21.4 bits (43), Expect = 7.0 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -1 Query: 140 EARAVSGHWAYDCCDDKMIETQTKMTL 60 E AV Y CCD+ ++ +T+ Sbjct: 210 EVPAVRNEKFYTCCDEPYLDITFNITM 236 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,573 Number of Sequences: 438 Number of extensions: 3888 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -