BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10o13 (596 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21C3.02c |sds3||Sds3-like family protein|Schizosaccharomyces... 27 1.6 SPAC3C7.04 |||transcription factor |Schizosaccharomyces pombe|ch... 27 2.1 SPBC21D10.11c |nfs1||iron-sulfur cluster assembly protein Nfs1|S... 26 4.8 SPBC1709.11c |png2||ING family homolog Png2|Schizosaccharomyces ... 26 4.8 SPBP4G3.03 |||PI31 proteasome regulator related|Schizosaccharomy... 25 6.3 SPCC74.01 |sly1||SNARE binding protein Sly1|Schizosaccharomyces ... 25 8.4 SPAC29A4.05 |cam2||myosin I light chain Cam2|Schizosaccharomyces... 25 8.4 >SPBC21C3.02c |sds3||Sds3-like family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 491 Score = 27.5 bits (58), Expect = 1.6 Identities = 30/129 (23%), Positives = 55/129 (42%), Gaps = 6/129 (4%) Frame = +1 Query: 40 DIIS--IKKQNSI*CVKFLILTVFEFSIELLNYTMSSLPIVSIIRRETFSSAHRLHSPFL 213 DII+ + QNS K + S L + ++SLP + + + S A + L Sbjct: 65 DIIAPQLPSQNSEIIEKNSPVNKLNSSTSLTTHQLASLPKLEVTDHDNVSEAETV---VL 121 Query: 214 SDEENKK--VYGKCNNPNGHGHNYVV--LVTVKGPVDPQTGMVMNITDLKKYIKTAILEP 381 +++E K+ + G + G + + + V V+PQ NIT + +K + E Sbjct: 122 NEDEEKETSLVGSVSVTEDLGDSSAIGRTILVNNSVEPQMENTANITIVSPSLKESDFES 181 Query: 382 LDHKNLDND 408 + DN+ Sbjct: 182 EEKATNDNN 190 >SPAC3C7.04 |||transcription factor |Schizosaccharomyces pombe|chr 1|||Manual Length = 783 Score = 27.1 bits (57), Expect = 2.1 Identities = 17/47 (36%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +1 Query: 391 KNLDNDVPYFKTMASTTENVAIYV-WDQLQRIMEKPQLLHEVKILEN 528 +NLD + P F+ NV +++ +DQ IM +P LLH++K +N Sbjct: 512 ENLDAEDPLFRA------NVHLHMTYDQAIIIMSRPVLLHKMKNAKN 552 >SPBC21D10.11c |nfs1||iron-sulfur cluster assembly protein Nfs1|Schizosaccharomyces pombe|chr 2|||Manual Length = 498 Score = 25.8 bits (54), Expect = 4.8 Identities = 21/86 (24%), Positives = 40/86 (46%), Gaps = 4/86 (4%) Frame = +1 Query: 175 TFSSAHRLHSPFLSDEENKKVYGKCNNPNGHG---HNYVVLVTVKGPVDPQTGMVMNITD 345 +F ++ R+ P +S++ +++YG N N + VT+ D +T Sbjct: 42 SFMTSSRMDKPSMSNKPREQMYGLGNMTAVQEPIPENSLKTVTL----DQAQTAASTVTG 97 Query: 346 LKK-YIKTAILEPLDHKNLDNDVPYF 420 L Y+ PLD++ LD+ +P+F Sbjct: 98 LHPIYMDFQATSPLDYRVLDSMLPFF 123 >SPBC1709.11c |png2||ING family homolog Png2|Schizosaccharomyces pombe|chr 2|||Manual Length = 305 Score = 25.8 bits (54), Expect = 4.8 Identities = 15/53 (28%), Positives = 22/53 (41%) Frame = +1 Query: 121 LLNYTMSSLPIVSIIRRETFSSAHRLHSPFLSDEENKKVYGKCNNPNGHGHNY 279 L+NY + P S RRET + HS S +E Y + + +Y Sbjct: 129 LMNYHSTVTPQTSERRRETRRHQNNQHSQQYSSQERSSSYNNFEDASSPQSSY 181 >SPBP4G3.03 |||PI31 proteasome regulator related|Schizosaccharomyces pombe|chr 2|||Manual Length = 241 Score = 25.4 bits (53), Expect = 6.3 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 316 QTGMVMNITDLKKYIKTAILEPLDHKNLDND 408 Q G + DL +I + +HK LDND Sbjct: 89 QQGQIETKPDLTLFINELLTTKKEHKKLDND 119 >SPCC74.01 |sly1||SNARE binding protein Sly1|Schizosaccharomyces pombe|chr 3|||Manual Length = 639 Score = 25.0 bits (52), Expect = 8.4 Identities = 14/54 (25%), Positives = 26/54 (48%) Frame = +1 Query: 328 VMNITDLKKYIKTAILEPLDHKNLDNDVPYFKTMASTTENVAIYVWDQLQRIME 489 V+ I+DL+K+ T + + DVP + T EN+ + + D + + E Sbjct: 62 VLRISDLRKHGVTVHMNITSFRQPIADVPAIYFVQPTQENIELIIEDLSKGLYE 115 >SPAC29A4.05 |cam2||myosin I light chain Cam2|Schizosaccharomyces pombe|chr 1|||Manual Length = 143 Score = 25.0 bits (52), Expect = 8.4 Identities = 18/54 (33%), Positives = 26/54 (48%), Gaps = 4/54 (7%) Frame = +1 Query: 343 DLKKYIKTA----ILEPLDHKNLDNDVPYFKTMASTTENVAIYVWDQLQRIMEK 492 D YI+TA ++ L K DN+V A T + + +D +QRIM K Sbjct: 90 DNSGYIETAKFADYMKTLGEKLSDNEVQLMVQEADPTNSGSFDYYDFVQRIMAK 143 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,432,553 Number of Sequences: 5004 Number of extensions: 50136 Number of successful extensions: 153 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 151 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 153 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -