BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10o09 (325 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 4.9 AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodo... 21 4.9 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 21 4.9 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 20 8.6 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 20 8.6 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 20 8.6 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 20 8.6 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 20 8.6 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 20 8.6 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 20 8.6 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 20 8.6 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 20 8.6 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 20 8.6 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 20 8.6 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 20 8.6 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 20 8.6 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 20 8.6 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 20 8.6 DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 20 8.6 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 20 8.6 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 20 8.6 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 20 8.6 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 20 8.6 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 20 8.6 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 20.6 bits (41), Expect = 4.9 Identities = 6/22 (27%), Positives = 14/22 (63%) Frame = -2 Query: 264 LSGIASKPFTS*GLPVSLISLW 199 + G++ KP + G + +I++W Sbjct: 155 VKGLSGKPLSINGALIRIIAIW 176 >AY703752-1|AAU12748.1| 152|Apis mellifera long-wavelength rhodopsin protein. Length = 152 Score = 20.6 bits (41), Expect = 4.9 Identities = 6/22 (27%), Positives = 14/22 (63%) Frame = -2 Query: 264 LSGIASKPFTS*GLPVSLISLW 199 + G++ KP + G + +I++W Sbjct: 121 VKGLSGKPLSINGALIRIIAIW 142 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 20.6 bits (41), Expect = 4.9 Identities = 6/22 (27%), Positives = 14/22 (63%) Frame = -2 Query: 264 LSGIASKPFTS*GLPVSLISLW 199 + G++ KP + G + +I++W Sbjct: 31 VKGLSGKPLSINGALIRIIAIW 52 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 22 LHNEKEKLLEERTSRKRYSRSREREQNSYK 51 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 19.8 bits (39), Expect = 8.6 Identities = 4/5 (80%), Positives = 5/5 (100%) Frame = +1 Query: 91 NCCCW 105 +CCCW Sbjct: 10 SCCCW 14 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 244 LHNEKEKLLEERTSRKRYSRSREREQNSYK 273 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 244 LHNEKEKLLEERTSRKRYSRSREREQNSYK 273 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQNSYK 284 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 19.8 bits (39), Expect = 8.6 Identities = 10/30 (33%), Positives = 13/30 (43%) Frame = +2 Query: 146 LGNHYRRSLTDRWSRALYQRDMRLTGNPYE 235 L N + L +R SR Y R N Y+ Sbjct: 255 LHNEKEKLLEERTSRKRYSRSREREQNSYK 284 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 19.8 bits (39), Expect = 8.6 Identities = 5/14 (35%), Positives = 11/14 (78%) Frame = -2 Query: 201 WYNARLHLSVSERL 160 W++ H+SV+++L Sbjct: 156 WHSPEAHISVAQKL 169 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,073 Number of Sequences: 438 Number of extensions: 1929 Number of successful extensions: 24 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7093251 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -