BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10o01 (137 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g63200.1 68416.m07100 patatin-related low similarity to patat... 28 0.98 At2g38060.1 68415.m04672 transporter-related low similarity to v... 25 6.9 >At3g63200.1 68416.m07100 patatin-related low similarity to patatin-like latex protein allergen Hev b 7 - Hevea brasiliensis, EMBL:AF113546; contains patatin domain PF01734 Length = 384 Score = 27.9 bits (59), Expect = 0.98 Identities = 14/35 (40%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = +2 Query: 11 CWXHEDYIRI---AVSDAGAEHLLQHLHDETXQSG 106 CW DY+RI ++ GAE LL+ ET G Sbjct: 305 CWNRTDYVRIQANGLTSGGAEELLKERGVETAPFG 339 >At2g38060.1 68415.m04672 transporter-related low similarity to vesicular glutamate transporter 3 [Homo sapiens] GI:21213895, brain specific Na+-dependent inorganic phosphate cotransporter [Rattus norvegicus] GI:507415; contains Pfam profile PF00083: major facilitator superfamily protein Length = 512 Score = 25.0 bits (52), Expect = 6.9 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = +3 Query: 9 TVGXMKTIYALLCLTLVQSISC-SIFMT 89 ++G M +LLCL +S SC ++FMT Sbjct: 400 SIGFMGPGLSLLCLNFAKSPSCAAVFMT 427 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,156,460 Number of Sequences: 28952 Number of extensions: 18909 Number of successful extensions: 47 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 47 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 47 length of database: 12,070,560 effective HSP length: 26 effective length of database: 11,317,808 effective search space used: 215038352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -