BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10n21 (590 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-7|CAJ14158.1| 284|Anopheles gambiae signal sequence re... 23 5.6 U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic aci... 23 7.4 >CR954257-7|CAJ14158.1| 284|Anopheles gambiae signal sequence receptor protein. Length = 284 Score = 23.4 bits (48), Expect = 5.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +3 Query: 231 LQSTSRCSRKTC*VFTARLFASGSRPIYACGYP 329 L++T T +FT L ASGS+ GYP Sbjct: 59 LETTKSPDADTYLLFTRPLHASGSQLELPAGYP 91 >U03849-1|AAA53488.1| 388|Anopheles gambiae putative nucleic acid binding protein protein. Length = 388 Score = 23.0 bits (47), Expect = 7.4 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -2 Query: 322 PHA*IGLDPLANSLAVKTQQVFREHL 245 PH +G DPL++ L ++ F + + Sbjct: 184 PHELVGTDPLSSPLQAAPREPFTDRI 209 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 620,785 Number of Sequences: 2352 Number of extensions: 11615 Number of successful extensions: 15 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56768445 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -