BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10n20 (608 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 31 0.45 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 31 0.45 At3g49900.1 68416.m05455 BTB/POZ domain-containing protein conta... 28 5.6 At4g28570.1 68417.m04087 alcohol oxidase-related low similarity ... 27 7.4 At4g10120.1 68417.m01655 sucrose-phosphate synthase, putative si... 27 9.7 At1g79500.3 68414.m09267 2-dehydro-3-deoxyphosphooctonate aldola... 27 9.7 At1g79500.2 68414.m09266 2-dehydro-3-deoxyphosphooctonate aldola... 27 9.7 At1g79500.1 68414.m09265 2-dehydro-3-deoxyphosphooctonate aldola... 27 9.7 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 31.5 bits (68), Expect = 0.45 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 75 VWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEK 209 +W ++ L L VF +A PF ++ P H+IED +E EK Sbjct: 1148 LWSLLNLLLPDVFDNRKAFHDWFAQPFQKEGPAHNIEDDWLETEK 1192 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 31.5 bits (68), Expect = 0.45 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +3 Query: 75 VWGIIQLTLMGVFYYIRAVALLEDLPFDEKNPPHSIEDFVIEVEK 209 +W ++ L L VF +A PF ++ P H+IED +E EK Sbjct: 1147 LWSLLNLLLPDVFDNRKAFHDWFAQPFQKEGPAHNIEDDWLETEK 1191 >At3g49900.1 68416.m05455 BTB/POZ domain-containing protein contains BTB/POZ domain, INTERPRO:IPR000210 Length = 517 Score = 27.9 bits (59), Expect = 5.6 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +1 Query: 472 HITQTIKTSSSSACISPLLDVNLSHSP 552 H + ++ +SSSS +SP +NLS SP Sbjct: 22 HHSSSLSSSSSSLSLSPKQPINLSSSP 48 >At4g28570.1 68417.m04087 alcohol oxidase-related low similarity to long chain fatty alcohol oxidase from Candida cloacae [GI:6983581], Candida tropicalis [GI:6983594] Length = 748 Score = 27.5 bits (58), Expect = 7.4 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -1 Query: 140 QQSDSSNIIKDAHQRQLNDAPYAQN*ATKRQFWSTQFAAH 21 Q+ I K+A + L++ TK ++W+T F+AH Sbjct: 640 QKMKCEAITKEAMEEFLDEVDAVGGVGTKGEYWTTYFSAH 679 >At4g10120.1 68417.m01655 sucrose-phosphate synthase, putative similar to sucrose-phosphate synthase, Zea mays, PIR2:JQ1329; contains non-consensus (GC) donor splice site at intron 4 Length = 1050 Score = 27.1 bits (57), Expect = 9.7 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 130 SLCWRIYHLMRKIRLIL 180 ++CWRI+HL RK + I+ Sbjct: 102 NICWRIWHLARKKKQIV 118 >At1g79500.3 68414.m09267 2-dehydro-3-deoxyphosphooctonate aldolase / phospho-2-dehydro-3-deoxyoctonate aldolase / 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase (KDSA) identical to Swiss-Prot:Q9AV97 2-dehydro-3-deoxyphosphooctonate aldolase (EC 4.1.2.16) (Phospho-2- dehydro-3-deoxyoctonate aldolase) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase) (KDO-8-phosphate synthetase) (KDO 8-P synthase) [Arabidopsis thaliana] Length = 290 Score = 27.1 bits (57), Expect = 9.7 Identities = 14/58 (24%), Positives = 26/58 (44%) Frame = -1 Query: 353 LTAKITTPSILHTN*GTIIQPKLMSRYNQCNQVQQCRNPTILCIQGISFFHFNDEVFD 180 L A T I++ G P +M N +++ NP ++ + + F +ND + D Sbjct: 123 LVAAAQTGKIINIKKGQFCAPSVME--NSAEKIRLAGNPNVMVCERGTMFGYNDLIVD 178 >At1g79500.2 68414.m09266 2-dehydro-3-deoxyphosphooctonate aldolase / phospho-2-dehydro-3-deoxyoctonate aldolase / 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase (KDSA) identical to Swiss-Prot:Q9AV97 2-dehydro-3-deoxyphosphooctonate aldolase (EC 4.1.2.16) (Phospho-2- dehydro-3-deoxyoctonate aldolase) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase) (KDO-8-phosphate synthetase) (KDO 8-P synthase) [Arabidopsis thaliana] Length = 290 Score = 27.1 bits (57), Expect = 9.7 Identities = 14/58 (24%), Positives = 26/58 (44%) Frame = -1 Query: 353 LTAKITTPSILHTN*GTIIQPKLMSRYNQCNQVQQCRNPTILCIQGISFFHFNDEVFD 180 L A T I++ G P +M N +++ NP ++ + + F +ND + D Sbjct: 123 LVAAAQTGKIINIKKGQFCAPSVME--NSAEKIRLAGNPNVMVCERGTMFGYNDLIVD 178 >At1g79500.1 68414.m09265 2-dehydro-3-deoxyphosphooctonate aldolase / phospho-2-dehydro-3-deoxyoctonate aldolase / 3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase (KDSA) identical to Swiss-Prot:Q9AV97 2-dehydro-3-deoxyphosphooctonate aldolase (EC 4.1.2.16) (Phospho-2- dehydro-3-deoxyoctonate aldolase) (3-deoxy-D-manno-octulosonic acid 8-phosphate synthetase) (KDO-8-phosphate synthetase) (KDO 8-P synthase) [Arabidopsis thaliana] Length = 290 Score = 27.1 bits (57), Expect = 9.7 Identities = 14/58 (24%), Positives = 26/58 (44%) Frame = -1 Query: 353 LTAKITTPSILHTN*GTIIQPKLMSRYNQCNQVQQCRNPTILCIQGISFFHFNDEVFD 180 L A T I++ G P +M N +++ NP ++ + + F +ND + D Sbjct: 123 LVAAAQTGKIINIKKGQFCAPSVME--NSAEKIRLAGNPNVMVCERGTMFGYNDLIVD 178 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,643,347 Number of Sequences: 28952 Number of extensions: 266173 Number of successful extensions: 628 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 628 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1216725696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -