Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov10n19
         (167 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_Q5CW09 Cluster: Hypothetical membrane associated protei...    30   8.9  

>UniRef50_Q5CW09 Cluster: Hypothetical membrane associated protein
           with a signal peptide and a transmembrane domain near
           the carboxy-terminus; n=2; Cryptosporidium|Rep:
           Hypothetical membrane associated protein with a signal
           peptide and a transmembrane domain near the
           carboxy-terminus - Cryptosporidium parvum Iowa II
          Length = 713

 Score = 30.3 bits (65), Expect = 8.9
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 4/50 (8%)
 Frame = +3

Query: 18  TMTERCQNKFVENFVNQNYIICFGITSA----SFAXIYYYRXHFVTFAFS 155
           TM + C N  V   +N  Y I  GIT       F  +Y Y  H +T +F+
Sbjct: 392 TMPKSCSNNLVALSLNNGYRIQLGITKTPKYIQFGKLYRYFEHSLTTSFT 441


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 103,126,703
Number of Sequences: 1657284
Number of extensions: 1098888
Number of successful extensions: 3229
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3177
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3229
length of database: 575,637,011
effective HSP length: 35
effective length of database: 517,632,071
effective search space used: 10352641420
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)