BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10n15 (518 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 24 3.5 AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein prot... 23 6.2 AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like pepti... 23 8.1 AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like pepti... 23 8.1 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 8.1 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 23.8 bits (49), Expect = 3.5 Identities = 14/65 (21%), Positives = 27/65 (41%) Frame = +2 Query: 323 TACSNPVSASKRFETQTIYKNSYLPATATIPTPVKPSPNIIASTAQMEGDTVQKLSYLPN 502 +A S P + +F + ++ A +P PV+ SP+ + A + + + L Sbjct: 908 SARSTPKKQNLKFIDEASTPSTSAMAATIVPNPVQASPSPATAPAPAKTTSTDSTNGLET 967 Query: 503 PVCVT 517 P T Sbjct: 968 PTSET 972 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +1 Query: 409 HTDAXEAVAKHHRFDSSNGRGHGAKVV 489 H A + +HH SNG HG ++ Sbjct: 649 HHQAHQHQGQHHAQHHSNGTHHGPSLM 675 >AJ010903-1|CAA09389.1| 373|Anopheles gambiae ICHIT protein protein. Length = 373 Score = 23.0 bits (47), Expect = 6.2 Identities = 16/58 (27%), Positives = 23/58 (39%) Frame = +2 Query: 260 TTYTMSYLDAKSDCRRQPILPTACSNPVSASKRFETQTIYKNSYLPATATIPTPVKPS 433 TT+ + SD P PT + V T T Y +Y P T+ P+ P+ Sbjct: 230 TTHAPTTTTTWSDLPPPP--PTTTTTTVWTDPTTTTTTDYTTAYPPTTSEPPSTPHPT 285 >AY324313-1|AAQ89698.1| 160|Anopheles gambiae insulin-like peptide 6 precursor protein. Length = 160 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 268 HNELLGREKRLSSTTHLTDCLLQPC 342 HNEL+ R + + +C L+PC Sbjct: 121 HNELIPARFRKNRGGIVEECCLRPC 145 >AY324309-1|AAQ89694.1| 160|Anopheles gambiae insulin-like peptide 3 precursor protein. Length = 160 Score = 22.6 bits (46), Expect = 8.1 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 268 HNELLGREKRLSSTTHLTDCLLQPC 342 HNEL+ R + + +C L+PC Sbjct: 121 HNELIPARFRKNRGGIVEECCLRPC 145 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 22.6 bits (46), Expect = 8.1 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +2 Query: 98 VTIGNNIYSSDPKHDVIPSPWKSI 169 V + N I+ + DV+PS WK I Sbjct: 231 VDVVNEIFCLTYQLDVLPSVWKYI 254 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 560,772 Number of Sequences: 2352 Number of extensions: 10848 Number of successful extensions: 30 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47360208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -