BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10n09 (645 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1446 - 30220158-30220278,30220866-30222229 29 4.2 06_03_1434 - 30139990-30140110,30140698-30142061 29 4.2 11_04_0144 + 14044973-14044984,14045050-14045183,14045329-140458... 28 5.5 09_01_0154 + 2298432-2299415 28 5.5 10_08_0409 - 17710118-17710624,17711003-17711701,17711828-17712121 28 7.3 01_06_1592 + 38495121-38495305,38496378-38496459,38496652-384967... 28 7.3 11_03_0157 + 10897769-10898066,10898308-10899461 27 9.7 04_04_1553 - 34363848-34366058,34369087-34370451 27 9.7 04_04_1550 - 34332948-34335986 27 9.7 >06_03_1446 - 30220158-30220278,30220866-30222229 Length = 494 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 183 SLLRRPGMWFVKWTPQMS*HSFESEVEDMRYSLH 284 S +RRPG W WT + S+E D +LH Sbjct: 338 SSVRRPGQWLTTWTMPIPVTSWEDWRPDCTANLH 371 >06_03_1434 - 30139990-30140110,30140698-30142061 Length = 494 Score = 28.7 bits (61), Expect = 4.2 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +3 Query: 183 SLLRRPGMWFVKWTPQMS*HSFESEVEDMRYSLH 284 S +RRPG W WT + S+E D +LH Sbjct: 338 SSVRRPGQWLTTWTMPIPVTSWEDWRPDCTANLH 371 >11_04_0144 + 14044973-14044984,14045050-14045183,14045329-14045824, 14046097-14046117,14047504-14047767,14048635-14048715 Length = 335 Score = 28.3 bits (60), Expect = 5.5 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -2 Query: 332 FNPMCSV*QLI*ILCPVQ*VSHVFDF*LEGMSTHLWSPFHE 210 F PM + + I LC + +H ++F S+ LW PFHE Sbjct: 69 FYPMEGLLEKIDHLCKAR--NHAYNFEFWPFSSALWKPFHE 107 >09_01_0154 + 2298432-2299415 Length = 327 Score = 28.3 bits (60), Expect = 5.5 Identities = 25/97 (25%), Positives = 40/97 (41%) Frame = -1 Query: 321 VFCITINMNSLSGAMSISCLRLLTRRNVNSFVESISRTTFLAFSVSCPISPAYNTEVALS 142 V ++I ++S G + L L R + + + T +A V I P Y ALS Sbjct: 206 VIPVSIAVSSAEGRWAAPALWLAWRL-MKARRKEAGVLTLIACLVPAAICPVYTIAAALS 264 Query: 141 NELLIGIPSWFTMTTPITPLWAWILLIVSSTSVAIMY 31 +ELL W L L ++S+T+ + Y Sbjct: 265 DELLFTFYVWLLGVVFGFFLLPVALQLLSTTAATVFY 301 >10_08_0409 - 17710118-17710624,17711003-17711701,17711828-17712121 Length = 499 Score = 27.9 bits (59), Expect = 7.3 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 195 FSVSCPISPAYNTEVALSNELLIGIPSWFTMTTPITP 85 F +S P++ +N E S +L +P+ FT+ ITP Sbjct: 40 FDIS-PVNYEFNVEAMSSEKLAFNLPAVFTIGPKITP 75 >01_06_1592 + 38495121-38495305,38496378-38496459,38496652-38496716, 38496914-38497013,38497300-38497341,38497486-38497527, 38497651-38497932 Length = 265 Score = 27.9 bits (59), Expect = 7.3 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = +2 Query: 137 SLDNATSVLYAGLIGQLTEKARNVVREMDSTNELTFLRVRSRRHEILIA 283 +L NA L IG +T K ++ +++ E R+RS++HE+L + Sbjct: 105 TLQNANRHLIGESIGNMTAKE---LKSLENRLEKGISRIRSKKHELLFS 150 >11_03_0157 + 10897769-10898066,10898308-10899461 Length = 483 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = -1 Query: 252 TRRNVNSFVESISRTTFLAFSVSCPISPAYNTEVALS---NELLIGIPSWFTMTTPIT 88 TR +V SF + T LAF + P+ ++++ LS + I W T+ TP+T Sbjct: 303 TRVSVASFAVVTALYTALAFVGASMFGPSVSSQITLSMPPGLAVTRIALWATVLTPVT 360 >04_04_1553 - 34363848-34366058,34369087-34370451 Length = 1191 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -1 Query: 312 ITINMNSLSGAMSISCLRLLTRRN 241 +++ NSLSG ++I C RLLTR N Sbjct: 764 VSLRNNSLSGEITIDC-RLLTRLN 786 >04_04_1550 - 34332948-34335986 Length = 1012 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/24 (54%), Positives = 18/24 (75%) Frame = -1 Query: 312 ITINMNSLSGAMSISCLRLLTRRN 241 +++ NSLSG ++I C RLLTR N Sbjct: 296 VSLRNNSLSGEITIDC-RLLTRLN 318 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,076,591 Number of Sequences: 37544 Number of extensions: 323433 Number of successful extensions: 706 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 706 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -