BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10n03 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 27 0.18 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 5.1 AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax prot... 22 5.1 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 21 6.7 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 21 6.7 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 26.6 bits (56), Expect = 0.18 Identities = 17/39 (43%), Positives = 23/39 (58%) Frame = +1 Query: 172 NFNETRKLDISFGSEYGCCIVSLGETKILSEVTCEVAQP 288 N + RK ++ GSEY IVSLGE K ++ CE +P Sbjct: 847 NLYDARKPYVN-GSEYHPSIVSLGEYKCVT-CKCENGKP 883 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 99 YLFIEL*KEFHTKDRISR 152 Y +EL KEFHT ++R Sbjct: 233 YQTLELEKEFHTNHYLTR 250 >AF146649-1|AAD38009.1| 96|Tribolium castaneum ultrathorax protein. Length = 96 Score = 21.8 bits (44), Expect = 5.1 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 99 YLFIEL*KEFHTKDRISR 152 Y +EL KEFHT ++R Sbjct: 15 YQTLELEKEFHTNHYLTR 32 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.4 bits (43), Expect = 6.7 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 379 DLTVYLVRLLEKCYKDSKCIDLESLCIVVEEKV 477 D+ +L+ L +C+ SKCI + + +E+KV Sbjct: 212 DMGEFLLYRLLRCWLISKCIYVFNPRYYLEKKV 244 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.4 bits (43), Expect = 6.7 Identities = 11/33 (33%), Positives = 20/33 (60%) Frame = +1 Query: 379 DLTVYLVRLLEKCYKDSKCIDLESLCIVVEEKV 477 D+ +L+ L +C+ SKCI + + +E+KV Sbjct: 212 DMGEFLLYRLLRCWLISKCIYVFNPRYYLEKKV 244 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 157,154 Number of Sequences: 336 Number of extensions: 3507 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -