BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10n02 (608 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 1.8 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.3 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 4.1 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 21 7.1 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 7.1 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = -1 Query: 608 YENVSFNHRMFNINYENKTK 549 Y N ++N+ +N NY N K Sbjct: 333 YNNNNYNNNNYNNNYNNNCK 352 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.3 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 7/43 (16%) Frame = +2 Query: 437 VESAKKEIGLW-------FTDKEVVGWTPANENWVYE*IYFNL 544 VE+AK +W TD+ WT NE +V +Y NL Sbjct: 1083 VETAKTNEEMWELIDTEKLTDRLPYPWTMDNERYVKVDMYMNL 1125 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.2 bits (45), Expect = 4.1 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = -2 Query: 118 YTIRLNHNKSTLTLFRHHEILLTCSI 41 Y + + +K T T+ +H I L CS+ Sbjct: 61 YPLPYSGSKCTWTITSYHRINLKCSL 86 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.4 bits (43), Expect = 7.1 Identities = 11/47 (23%), Positives = 22/47 (46%) Frame = +2 Query: 275 SSGPVVPMVWEGLNVVKTGRQMLGATNPADSQPGTIRGDLCIQVGRN 415 S+ V + G +V +G+Q G +QP T++ + + +N Sbjct: 909 SNSQVQGVAVPGSGIVASGQQHAGGWQSIYAQPQTVQDQIVSEYYQN 955 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.4 bits (43), Expect = 7.1 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -2 Query: 85 LTLFRHHEILLTCSIN 38 L + +HH + CS+N Sbjct: 123 LQMTKHHNFIKVCSVN 138 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,132 Number of Sequences: 438 Number of extensions: 3432 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17971191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -