BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10m18 (364 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal prote... 56 8e-09 U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical pr... 27 4.0 AL008869-2|CAC42315.1| 810|Caenorhabditis elegans Hypothetical ... 27 4.0 AL008869-1|CAA15516.1| 808|Caenorhabditis elegans Hypothetical ... 27 4.0 AB032749-1|BAA92158.1| 810|Caenorhabditis elegans EAT-20B protein. 27 4.0 AB032748-1|BAA92157.1| 808|Caenorhabditis elegans EAT-20A protein. 27 4.0 AF016682-8|AAO38605.1| 422|Caenorhabditis elegans Hypothetical ... 27 5.3 Z81492-3|CAB04030.1| 382|Caenorhabditis elegans Hypothetical pr... 26 9.3 AC024818-1|AAK29945.2| 375|Caenorhabditis elegans Hypothetical ... 26 9.3 >U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 30 protein. Length = 130 Score = 56.0 bits (129), Expect = 8e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +3 Query: 276 LLGGKVHGSLARAGKVKGQTPKVEKQQKK 362 LLGGKVHGSLARAGKV+ QTPKV+KQ KK Sbjct: 68 LLGGKVHGSLARAGKVRAQTPKVDKQDKK 96 >U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical protein C41A3.1 protein. Length = 7829 Score = 27.1 bits (57), Expect = 4.0 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +1 Query: 67 FTICSCISEGNRHTSWTSMARS 132 F I C G HT WT RS Sbjct: 4931 FIIICCFENGTSHTEWTGTLRS 4952 >AL008869-2|CAC42315.1| 810|Caenorhabditis elegans Hypothetical protein H30A04.1b protein. Length = 810 Score = 27.1 bits (57), Expect = 4.0 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -3 Query: 185 FIANCSKSTNAFLDLTNGLLAIDVQDVCRLPSDMQLHIVKSYQPSLTSKRN 33 F AN + FLD N I+ +DV L + Q + K PS+ N Sbjct: 165 FTANALNCSCPFLDAANEDSEIENEDVDMLANTPQFPLFKGIDPSVLGSAN 215 >AL008869-1|CAA15516.1| 808|Caenorhabditis elegans Hypothetical protein H30A04.1a protein. Length = 808 Score = 27.1 bits (57), Expect = 4.0 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -3 Query: 185 FIANCSKSTNAFLDLTNGLLAIDVQDVCRLPSDMQLHIVKSYQPSLTSKRN 33 F AN + FLD N I+ +DV L + Q + K PS+ N Sbjct: 165 FTANALNCSCPFLDAANEDSEIENEDVDMLANTPQFPLFKGIDPSVLGSAN 215 >AB032749-1|BAA92158.1| 810|Caenorhabditis elegans EAT-20B protein. Length = 810 Score = 27.1 bits (57), Expect = 4.0 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -3 Query: 185 FIANCSKSTNAFLDLTNGLLAIDVQDVCRLPSDMQLHIVKSYQPSLTSKRN 33 F AN + FLD N I+ +DV L + Q + K PS+ N Sbjct: 165 FTANALNCSCPFLDAANEDSEIENEDVDMLANTPQFPLFKGIDPSVLGSAN 215 >AB032748-1|BAA92157.1| 808|Caenorhabditis elegans EAT-20A protein. Length = 808 Score = 27.1 bits (57), Expect = 4.0 Identities = 16/51 (31%), Positives = 22/51 (43%) Frame = -3 Query: 185 FIANCSKSTNAFLDLTNGLLAIDVQDVCRLPSDMQLHIVKSYQPSLTSKRN 33 F AN + FLD N I+ +DV L + Q + K PS+ N Sbjct: 165 FTANALNCSCPFLDAANEDSEIENEDVDMLANTPQFPLFKGIDPSVLGSAN 215 >AF016682-8|AAO38605.1| 422|Caenorhabditis elegans Hypothetical protein T07D3.9b protein. Length = 422 Score = 26.6 bits (56), Expect = 5.3 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -2 Query: 186 LHRQLQQEYECVP*SDQWTPGH*R-PGRVSIAL*YATAYCKI 64 LH ++E EC P + H + PGR S A YA C+I Sbjct: 375 LHDGKRRESECAPCGSKALCAHHKLPGRTSAAEQYAEKNCEI 416 >Z81492-3|CAB04030.1| 382|Caenorhabditis elegans Hypothetical protein E03H4.6 protein. Length = 382 Score = 25.8 bits (54), Expect = 9.3 Identities = 13/36 (36%), Positives = 17/36 (47%) Frame = -3 Query: 182 IANCSKSTNAFLDLTNGLLAIDVQDVCRLPSDMQLH 75 I N + FL LL V VC PS+++LH Sbjct: 42 IRNTEVNVKRFLSSVFDLLTDPVCPVCEFPSNVELH 77 >AC024818-1|AAK29945.2| 375|Caenorhabditis elegans Hypothetical protein Y54H5A.2 protein. Length = 375 Score = 25.8 bits (54), Expect = 9.3 Identities = 12/39 (30%), Positives = 16/39 (41%) Frame = +3 Query: 72 NMQLHIRGQSTHVLDVNGQESIGQIKERIRTLAAVGDED 188 N+ H + H L IGQ+ I+ GDED Sbjct: 119 NVSRHFPDRVDHKLKARNANYIGQLLNEIKKSVETGDED 157 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,747,960 Number of Sequences: 27780 Number of extensions: 132292 Number of successful extensions: 328 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 320 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 12,740,198 effective HSP length: 73 effective length of database: 10,712,258 effective search space used: 503476126 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -