BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10m16 (605 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.3 AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. 23 2.3 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 23 3.1 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 22 5.4 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 9.4 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 471 TNICEELGKEARAEAQRVAELHKAGSQLRIDLIE 572 TNI EE+ KEA+ + + L Q + D+ E Sbjct: 433 TNISEEVLKEAKIIQEEIRTLLDESIQRKSDITE 466 >AB050744-1|BAB17753.1| 238|Apis mellifera period protein protein. Length = 238 Score = 23.0 bits (47), Expect = 2.3 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 471 TNICEELGKEARAEAQRVAELHKAGSQLRIDLIE 572 TNI EE+ KEA+ + + L Q + D+ E Sbjct: 139 TNISEEVLKEAKIIQEEIRTLLDESIQRKSDITE 172 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.6 bits (46), Expect = 3.1 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -3 Query: 405 WNSANSEAGVRHLYNGKHRLYKP 337 WN + GVR L HRL+KP Sbjct: 87 WN-VSDYGGVRDLRIPPHRLWKP 108 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.8 bits (44), Expect = 5.4 Identities = 13/47 (27%), Positives = 18/47 (38%) Frame = -1 Query: 482 TNVSTGRRISVFICSITAITDSVINPGTRQILRPVSGICTMENTVYT 342 T + RR S IC + + +SV + S TME T Sbjct: 373 TIIDVSRRRSSLICDVYGVNESVSYERGSMTVSVTSKPSTMERQTQT 419 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 21.0 bits (42), Expect = 9.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 Query: 583 YFLFSMRSILNWLPALCNS 527 YF SMRS L W CN+ Sbjct: 87 YFFMSMRSELPW--GSCNN 103 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,355 Number of Sequences: 438 Number of extensions: 3056 Number of successful extensions: 11 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17848938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -