BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10m16 (605 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g56360.1 68418.m07034 calmodulin-binding protein similar to a... 139 1e-33 At2g42390.1 68415.m05246 protein kinase C substrate, heavy chain... 109 1e-24 At1g72270.1 68414.m08355 expressed protein 32 0.26 At2g29310.1 68415.m03560 tropinone reductase, putative / tropine... 30 1.4 At3g10800.1 68416.m01300 bZIP transcription factor family protei... 29 2.4 At1g77210.1 68414.m08993 sugar transporter, putative similar to ... 28 5.5 At1g14220.1 68414.m01683 ribonuclease T2 family protein contains... 28 5.5 At3g26120.1 68416.m03257 RNA-binding protein, putative similar t... 27 7.3 At2g32470.1 68415.m03967 F-box family protein-related contains T... 27 7.3 At1g22200.1 68414.m02776 expressed protein 27 7.3 >At5g56360.1 68418.m07034 calmodulin-binding protein similar to alpha glucosidase II beta subunit from GI:2104691 [Mus musculus] Length = 647 Score = 139 bits (337), Expect = 1e-33 Identities = 66/150 (44%), Positives = 87/150 (58%), Gaps = 1/150 (0%) Frame = +3 Query: 135 SYFVIFCSVIIFAQSDVPRP-RGVSLSKASLYLPTKDFTCFDGTATIPFSYVNDDYCDCF 311 S+ ++ S I + S P G+S Y + + C DG+ + +NDD+CDC Sbjct: 17 SFLLLLASAIRSSSSPPNDPFLGISPQDEKYYKSSSEIKCKDGSKKFTKAQLNDDFCDCS 76 Query: 312 DGSDEPGTSACINGVFHCTNAGHRPQNLPSSRVNDGVCDCCDGTDEYANPTACTNICEEL 491 DG+DEPGTSAC G F+C NAGH P L SSRVNDG+CDCCDG+DEY +C N C E Sbjct: 77 DGTDEPGTSACPTGKFYCRNAGHSPVILFSSRVNDGICDCCDGSDEYDGHVSCQNTCWEA 136 Query: 492 GKEARAEAQRVAELHKAGSQLRIDLIEKRK 581 GK AR ++ E + G +R IE+ K Sbjct: 137 GKAARENLKKKIETYNQGLVIRRQEIEQAK 166 >At2g42390.1 68415.m05246 protein kinase C substrate, heavy chain-related similar to Protein kinase C substrate, 80 kDa protein, heavy chain (PKCSH) (80K-H protein) (Swiss-Prot:P14314) [Homo sapiens]; contains 1 transmembrane domain; Length = 212 Score = 109 bits (262), Expect = 1e-24 Identities = 44/86 (51%), Positives = 57/86 (66%) Frame = +3 Query: 225 YLPTKDFTCFDGTATIPFSYVNDDYCDCFDGSDEPGTSACINGVFHCTNAGHRPQNLPSS 404 Y + C DG+ + +ND++CDC DG+DEPGTSAC NG F+C N G P+ + SS Sbjct: 35 YFDSDVIKCKDGSKSFTRDRLNDNFCDCLDGTDEPGTSACPNGKFYCRNIGSSPKFVYSS 94 Query: 405 RVNDGVCDCCDGTDEYANPTACTNIC 482 RVND +CDCCDG+DEY + C N C Sbjct: 95 RVNDRICDCCDGSDEYESSIHCPNTC 120 >At1g72270.1 68414.m08355 expressed protein Length = 2777 Score = 32.3 bits (70), Expect = 0.26 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 2/73 (2%) Frame = -1 Query: 554 QLAACFMQLCYSLSFCSGFFSELFTNVSTGRRISVFICSITAITDSVINPGTRQILR--P 381 ++A ++ C LS+CS FFS + T TG S F+ + ITD++ + + + Sbjct: 2338 KMARHLVENCGLLSWCSSFFS-MLTTKPTGDEDSRFVVVLEVITDALASRNDTEWSQRSA 2396 Query: 380 VSGICTMENTVYT 342 + G+ + + +YT Sbjct: 2397 LEGLMEISSRLYT 2409 >At2g29310.1 68415.m03560 tropinone reductase, putative / tropine dehydrogenase, putative similar to tropinone reductase SP:P50165 from [Datura stramonium] Length = 262 Score = 29.9 bits (64), Expect = 1.4 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = -1 Query: 575 FFYEVYSQL--AACFMQLCYSLSFCSGFFSELFTNVSTGRRISVFICSITAITDSVINPG 402 F Y + + L A F QL + L SGF S +F + +TG +SV SI ++T +N Sbjct: 111 FSYHISTNLEPAFHFSQLSHLLLKASGFGSIVFMSSATG-VVSVQCGSIYSLTKGALNQL 169 Query: 401 TRQI 390 TR + Sbjct: 170 TRNL 173 >At3g10800.1 68416.m01300 bZIP transcription factor family protein contains Pfam profile: PF00170 bZIP transcription factor; contains similarity to TGACG-sequence specific DNA-binding protein TGA-1B (HSBF) GB:P14233 [Nicotiana tabacum] Length = 675 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 369 NAGHRPQNLPSSRVNDGVCDCCDGTDEYANP 461 N+G N+ SSR++ G D C G D A+P Sbjct: 386 NSGISEGNIHSSRISHGERDSCGGVDYNAHP 416 >At1g77210.1 68414.m08993 sugar transporter, putative similar to monosaccharide transporter PaMst-1 [Picea abies] GI:2258137, sugar carrier protein GI:169735 from [Ricinus communis], glucose transporter [Saccharum hybrid cultivar H65-7052] GI:347855; contains Pfam profile PF00083: major facilitator superfamily protein Length = 504 Score = 27.9 bits (59), Expect = 5.5 Identities = 17/62 (27%), Positives = 27/62 (43%) Frame = -1 Query: 557 SQLAACFMQLCYSLSFCSGFFSELFTNVSTGRRISVFICSITAITDSVINPGTRQILRPV 378 +Q+ F Y S F + T + GRR S+ + S++ VIN + IL + Sbjct: 82 NQILTLFTSSLYFAGLISTFGASYVTRIY-GRRGSILVGSVSFFLGGVINAAAKNILMLI 140 Query: 377 SG 372 G Sbjct: 141 LG 142 >At1g14220.1 68414.m01683 ribonuclease T2 family protein contains similarity to S-like ribonuclease PD1 GI:9957752 from [Prunus dulcis]; contains ribonuclease T2 family histidine protein motif Length = 228 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/54 (27%), Positives = 23/54 (42%) Frame = +3 Query: 231 PTKDFTCFDGTATIPFSYVNDDYCDCFDGSDEPGTSACINGVFHCTNAGHRPQN 392 P +DF F P +Y + C+ S +P I+G++ N G P N Sbjct: 24 PQEDFDFFYFVLQWPGAYCDTSRACCYPTSGKPAADFGIHGLWPNYNGGSWPSN 77 >At3g26120.1 68416.m03257 RNA-binding protein, putative similar to GB:AAC39463 from [Zea mays], PF00076 RNA recognition motif (2 copies) Length = 615 Score = 27.5 bits (58), Expect = 7.3 Identities = 12/42 (28%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +1 Query: 139 IS*YFVPSSYLPSPMCLDPAVYLCLKHL-SIYRQKILLVLME 261 +S + + + P C DP L +K++ + Y QK+LL +++ Sbjct: 388 LSQFLISEETMEDPSCRDPRTTLMIKNIPNKYSQKLLLDMLD 429 >At2g32470.1 68415.m03967 F-box family protein-related contains TIGRFAM TIGR01640 : F-box protein interaction domain; similar to F-box protein Fbx8 (GI:6164735) [Homo sapiens] Length = 288 Score = 27.5 bits (58), Expect = 7.3 Identities = 14/47 (29%), Positives = 25/47 (53%) Frame = -1 Query: 485 FTNVSTGRRISVFICSITAITDSVINPGTRQILRPVSGICTMENTVY 345 F N ++ F+C + +V NP TRQI++ + + T EN ++ Sbjct: 6 FVNYIRSPPVNGFVCCTRGSSIAVCNPTTRQIVK-LPDVVTNENYMH 51 >At1g22200.1 68414.m02776 expressed protein Length = 386 Score = 27.5 bits (58), Expect = 7.3 Identities = 16/59 (27%), Positives = 27/59 (45%) Frame = +3 Query: 411 NDGVCDCCDGTDEYANPTACTNICEELGKEARAEAQRVAELHKAGSQLRIDLIEKRK*E 587 N+ C C G + A+ AC N CEE+ + R + +++ R ++K K E Sbjct: 142 NETYCGSCFGAE--ASDDACCNSCEEVREAYRKKGWALSDPESIDQCKREGFVQKVKDE 198 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,543,715 Number of Sequences: 28952 Number of extensions: 236069 Number of successful extensions: 655 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 635 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -