BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10m13 (605 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 6.1 AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH trans... 21 6.1 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 8.1 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 8.1 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +3 Query: 93 YLEITADSIFNFVICAFNC 149 YLEI I+N C NC Sbjct: 783 YLEIKCKRIYNEKQCCKNC 801 >AJ829922-1|CAH25640.1| 193|Tribolium castaneum twist bHLH transcription factor protein. Length = 193 Score = 21.4 bits (43), Expect = 6.1 Identities = 16/62 (25%), Positives = 29/62 (46%) Frame = +3 Query: 282 RTQMRVRNLNRYLRPMRCSRILTKGEFMIKVVNKH*RKGVVVVVDFLHQWISLTCSLEVD 461 R + R ++LN +R S + + K+ K +DFL+ +S +L+VD Sbjct: 104 RERQRTQSLNEAFASLRKSIPTMPSDKLSKIQTL---KLAARYIDFLYHVLSNENALDVD 160 Query: 462 LV 467 L+ Sbjct: 161 LI 162 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.0 bits (42), Expect = 8.1 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +2 Query: 158 LGIIKMVKETTYYDILGVKPN 220 L ++ V T YYD + PN Sbjct: 217 LTVLPNVNSTVYYDPRALSPN 237 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 21.0 bits (42), Expect = 8.1 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +1 Query: 28 LTCSKVSSCLSFHAKY 75 L S +SSCLSF +++ Sbjct: 121 LRASLISSCLSFFSQW 136 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 131,148 Number of Sequences: 336 Number of extensions: 2475 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15352827 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -