BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10m10 (594 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35592| Best HMM Match : zf-CCHC (HMM E-Value=0.0087) 30 1.2 SB_35605| Best HMM Match : Treacle (HMM E-Value=0.54) 29 2.1 SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) 29 2.8 SB_2209| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.8 SB_44610| Best HMM Match : PI3Ka (HMM E-Value=6.1e-32) 29 2.8 SB_56517| Best HMM Match : CUB (HMM E-Value=0.0011) 28 6.5 SB_3410| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.6 SB_59527| Best HMM Match : DUF382 (HMM E-Value=4.1e-26) 27 8.6 >SB_35592| Best HMM Match : zf-CCHC (HMM E-Value=0.0087) Length = 556 Score = 30.3 bits (65), Expect = 1.2 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +3 Query: 354 RAIDKLPVAPHYLQETLKHEPKYVLEAAKFEPKYEIEPYYTGEPVPLSNSKY 509 + +D L HYL ++++ PK E AK PKY T E P S Y Sbjct: 453 KKLDFLTNIVHYLSNSVRNVPKGKEELAKLIPKYHEIMIKTIEQDPSSEKSY 504 >SB_35605| Best HMM Match : Treacle (HMM E-Value=0.54) Length = 776 Score = 29.5 bits (63), Expect = 2.1 Identities = 14/28 (50%), Positives = 16/28 (57%) Frame = +1 Query: 175 QSTAQLSRQPSHPRHVK*PQNRQHWIRT 258 +S QL RQPS P H + RQH RT Sbjct: 275 ESLDQLERQPSSPSHSRSSGGRQHACRT 302 >SB_42767| Best HMM Match : Thyroglobulin_1 (HMM E-Value=0) Length = 6725 Score = 29.1 bits (62), Expect = 2.8 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -1 Query: 576 GIEKIVSHXSHTRGKHSAHKNQCTLNWTTAPVPLCNT 466 G ++ VS H G+ H+N C+L++T P+C T Sbjct: 5533 GTDEGVSEVLHVAGEKRLHRNTCSLDYT----PVCGT 5565 >SB_2209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 256 Score = 29.1 bits (62), Expect = 2.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 357 AIDKLPVAPHYLQETLKHEPKYVLEAAKFEPKY 455 A D +P+Y + H P Y L+A+ P Y Sbjct: 203 APDAFAHSPNYAPDAFAHSPNYALDASAHSPNY 235 >SB_44610| Best HMM Match : PI3Ka (HMM E-Value=6.1e-32) Length = 773 Score = 29.1 bits (62), Expect = 2.8 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 3/58 (5%) Frame = +3 Query: 357 AIDKLPVAPHYLQETLKHEPKYVLEAAKF---EPKYEIEPYYTGEPVPLSNSKYIGSY 521 A+ +L A L + L++EP E + EP E EP Y+ +P LS KY+GS+ Sbjct: 340 AVSRLKEANDELVQALRYEPVQEEEKSTEDLQEPPQE-EPTYSRDP--LSQGKYLGSF 394 >SB_56517| Best HMM Match : CUB (HMM E-Value=0.0011) Length = 734 Score = 27.9 bits (59), Expect = 6.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +3 Query: 447 PKYEIEPYYTGEPVPLSNSKYI 512 P Y+IEP Y G +P+ + Y+ Sbjct: 201 PSYDIEPSYNGNSLPMIKNLYV 222 >SB_3410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1256 Score = 27.5 bits (58), Expect = 8.6 Identities = 17/52 (32%), Positives = 24/52 (46%) Frame = +3 Query: 354 RAIDKLPVAPHYLQETLKHEPKYVLEAAKFEPKYEIEPYYTGEPVPLSNSKY 509 + +D L HYL +++++ K E AK PKY T E P S Y Sbjct: 528 KELDFLTNIVHYLSDSVRNVHKGKEELAKLIPKYHEIMIKTIEQDPSSEKSY 579 >SB_59527| Best HMM Match : DUF382 (HMM E-Value=4.1e-26) Length = 800 Score = 27.5 bits (58), Expect = 8.6 Identities = 18/54 (33%), Positives = 24/54 (44%), Gaps = 5/54 (9%) Frame = +3 Query: 381 PHYLQETLKHEPKYVLEAAKFEPKYEIEPYYTGEPVPLS-----NSKYIGSYEP 527 P Y+ EP+Y+ EP+Y I P T EP +S +YI EP Sbjct: 349 PQYIAPQETQEPQYIAPQETQEPQY-IAPQETQEPQYISPQETQEPQYIAPQEP 401 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,236,023 Number of Sequences: 59808 Number of extensions: 307888 Number of successful extensions: 901 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 895 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -