BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10l24 (597 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 23 2.3 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.0 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 9.2 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 9.2 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 9.2 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = +3 Query: 351 VDRSTMYQQFHDFINNCNGEQVRFATDL 434 + RS +QF D + CN VR D+ Sbjct: 88 ITRSGTREQFIDMVARCNKAGVRIYVDV 115 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.6 bits (46), Expect = 3.0 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = +3 Query: 486 PIRGLEILKKAIRKIQLFDSQLTSIHADLCQLCL 587 P+R LEIL+ + ++ F +++A L +L L Sbjct: 888 PLRSLEILRLSGNRLVTFPVWQVTLNARLVELSL 921 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -3 Query: 364 VDLSTSGLPGGKENLATRTAKTPNECCWIS 275 V+L + +PG + +A+ T T W S Sbjct: 253 VELQSENIPGFDDYMASLTPDTNRRNPWFS 282 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/40 (25%), Positives = 17/40 (42%) Frame = +3 Query: 366 MYQQFHDFINNCNGEQVRFATDLYADLCHLLTNHLVEIKQ 485 +Y+QF F + +V D Y C L + + +Q Sbjct: 519 LYEQFDSFCGQLDVYKVETIGDAYCVACGLHRDTYIHAQQ 558 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 9.2 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -3 Query: 364 VDLSTSGLPGGKENLATRTAKTPNECCWIS 275 V+L + +PG + +A+ T T W S Sbjct: 343 VELQSENIPGFDDYMASLTPDTNRRNPWFS 372 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 154,314 Number of Sequences: 438 Number of extensions: 3271 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -