Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov10l23
         (575 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

07_01_0128 + 956953-957166,957657-958309                               29   3.5  

>07_01_0128 + 956953-957166,957657-958309
          Length = 288

 Score = 28.7 bits (61), Expect = 3.5
 Identities = 19/59 (32%), Positives = 32/59 (54%), Gaps = 6/59 (10%)
 Frame = +1

Query: 406 EGLESRLTLPECKISSTIENYSDIILN------ALDYVHLNESEPEKVPEQNVLNNHQE 564
           EG+E+   + +  +S TI    D+I        A  Y+ LN+SEP+++  +  L+NH E
Sbjct: 95  EGIENGSWIDDLDLSGTIPPTVDLISQLVSLWEATQYIILNQSEPDQITWK--LSNHGE 151


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,964,149
Number of Sequences: 37544
Number of extensions: 202145
Number of successful extensions: 436
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 426
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 435
length of database: 14,793,348
effective HSP length: 78
effective length of database: 11,864,916
effective search space used: 1340735508
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)