Bombyx BLAST Result against nematostella

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov10l23
         (575 letters)

Database: nematostella 
           59,808 sequences; 16,821,457 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.)              28   4.8  

>SB_59261| Best HMM Match : No HMM Matches (HMM E-Value=.)
          Length = 5445

 Score = 28.3 bits (60), Expect = 4.8
 Identities = 14/40 (35%), Positives = 20/40 (50%)
 Frame = -1

Query: 272  QNCFGRVSPSNTFILVQKQNISTAFGSKFSLSQDATSFMQ 153
            +NC    SPS T + V   ++ T+    F    D TSFM+
Sbjct: 976  ENCEYTFSPSKTHVAVAVFSLDTSVEVNFDSYMDKTSFMR 1015


  Database: nematostella
    Posted date:  Oct 22, 2007  1:22 PM
  Number of letters in database: 16,821,457
  Number of sequences in database:  59,808
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,727,704
Number of Sequences: 59808
Number of extensions: 253830
Number of successful extensions: 638
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 590
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 638
length of database: 16,821,457
effective HSP length: 78
effective length of database: 12,156,433
effective search space used: 1373676929
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)