BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10l23 (575 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U64836-1|AAX22289.1| 321|Caenorhabditis elegans Serpentine rece... 30 1.4 Z69883-1|CAA93743.1| 829|Caenorhabditis elegans Hypothetical pr... 28 5.5 Z68493-4|CAA92791.1| 520|Caenorhabditis elegans Hypothetical pr... 27 9.5 U64836-2|AAG24060.2| 137|Caenorhabditis elegans Serpentine rece... 27 9.5 AL021567-5|CAO78719.1| 145|Caenorhabditis elegans Hypothetical ... 27 9.5 AL021567-4|CAA16507.1| 181|Caenorhabditis elegans Hypothetical ... 27 9.5 >U64836-1|AAX22289.1| 321|Caenorhabditis elegans Serpentine receptor, class x protein92, isoform b protein. Length = 321 Score = 29.9 bits (64), Expect = 1.4 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 7/81 (8%) Frame = -1 Query: 539 CSGTFSGSLSLRCT*SRAFKIMS-L*FSIVLLILHSGKVRRLSKPSVFFRSG------CT 381 C+ T + ++CT F +M+ L F L ILHS K R ++ V R C Sbjct: 176 CNSTENALEMIKCT----FIMMAILNFITFLKILHSYKKSRKTETVVGARKRMCKNILCF 231 Query: 380 VMTMLVFDIMFLRVTFTFKAS 318 + T+L + F+ +TFTFK S Sbjct: 232 LQTILQDSLYFIDMTFTFKLS 252 >Z69883-1|CAA93743.1| 829|Caenorhabditis elegans Hypothetical protein C27C12.7 protein. Length = 829 Score = 27.9 bits (59), Expect = 5.5 Identities = 13/40 (32%), Positives = 21/40 (52%) Frame = -1 Query: 413 KPSVFFRSGCTVMTMLVFDIMFLRVTFTFKASVMNVYADS 294 K F RS C V +++ I V FTF + +N+ +D+ Sbjct: 19 KHGYFARSCCVVFILIICVIFVFSVIFTFMQNPINLNSDN 58 >Z68493-4|CAA92791.1| 520|Caenorhabditis elegans Hypothetical protein C33A12.6 protein. Length = 520 Score = 27.1 bits (57), Expect = 9.5 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +1 Query: 427 TLPECKISSTIENYSDIILNALDYVHLNESEPE 525 ++P+ EN SD I+N LD VHL + P+ Sbjct: 314 SMPDTTFIWKYENTSDPIVNHLDNVHLGDWLPQ 346 >U64836-2|AAG24060.2| 137|Caenorhabditis elegans Serpentine receptor, class x protein92, isoform a protein. Length = 137 Score = 27.1 bits (57), Expect = 9.5 Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 6/55 (10%) Frame = -1 Query: 464 FSIVLLILHSGKVRRLSKPSVFFRSG------CTVMTMLVFDIMFLRVTFTFKAS 318 F L ILHS K R ++ V R C + T+L + F+ +TFTFK S Sbjct: 14 FITFLKILHSYKKSRKTETVVGARKRMCKNILCFLQTILQDSLYFIDMTFTFKLS 68 >AL021567-5|CAO78719.1| 145|Caenorhabditis elegans Hypothetical protein F21A10.1b protein. Length = 145 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 118 FIKMDLSLLCRSCMKEVASWERENFDPK 201 F+K LS+LCR + E W + +DPK Sbjct: 38 FVKA-LSILCRGTLDEKLDWLYKLYDPK 64 >AL021567-4|CAA16507.1| 181|Caenorhabditis elegans Hypothetical protein F21A10.1a protein. Length = 181 Score = 27.1 bits (57), Expect = 9.5 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 118 FIKMDLSLLCRSCMKEVASWERENFDPK 201 F+K LS+LCR + E W + +DPK Sbjct: 74 FVKA-LSILCRGTLDEKLDWLYKLYDPK 100 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,405,570 Number of Sequences: 27780 Number of extensions: 211829 Number of successful extensions: 556 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 550 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 556 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1194789454 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -