BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10l22 (590 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_37985| Best HMM Match : No HMM Matches (HMM E-Value=.) 101 3e-22 SB_13806| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_33893| Best HMM Match : Astacin (HMM E-Value=0.0004) 29 2.1 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 29 3.8 SB_58287| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.0 SB_42627| Best HMM Match : DUF164 (HMM E-Value=0.33) 28 5.0 SB_39015| Best HMM Match : Lectin_C (HMM E-Value=3.2e-28) 28 5.0 SB_57637| Best HMM Match : SRP40_C (HMM E-Value=2.3e-08) 28 5.0 SB_32968| Best HMM Match : SRP40_C (HMM E-Value=0.013) 28 5.0 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 6.6 SB_9776| Best HMM Match : 7tm_1 (HMM E-Value=8.2e-08) 28 6.6 SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) 27 8.7 SB_23758| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.7 SB_10321| Best HMM Match : Urotensin_II (HMM E-Value=6) 27 8.7 >SB_37985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 586 Score = 101 bits (243), Expect = 3e-22 Identities = 53/164 (32%), Positives = 82/164 (50%), Gaps = 1/164 (0%) Frame = +3 Query: 96 EITVNKTEGYDDIITNFDIKETCKWIERKKFAKVCLQFPDDLLEVSCKVYKEIKDRIEVD 275 ++ KTE + ++ ++I+ + + I F KV LQFPD LL S V + I+ R Sbjct: 36 DVPSTKTESIERMVEVYEIERSVQVITSSGFNKVALQFPDSLLADSASVARLIEQRASCK 95 Query: 276 LYIMGDTSYASCCIDSVAAMHVQANGIVHYGHKCFSKTD-IPVYMVLPKEKLDFDAAINT 452 +I+ DTSY SCC+D +AA H A I+HYG C S+T +PV V K ++ Sbjct: 96 AFILADTSYGSCCVDEIAAEHADAELIIHYGQACLSQTKRLPVLYVFGKNPINVIECSQH 155 Query: 453 LKEKYDSDDNMKLCLFYGAEFEHCNENITRKWFQKYPKSYICXI 584 ++ Y D +++ +FY + HC + YP I I Sbjct: 156 FRQLY-PDTGIRVLVFYDVVYNHCIGALDEALSPLYPNMTISTI 198 >SB_13806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 30.3 bits (65), Expect = 1.2 Identities = 26/72 (36%), Positives = 35/72 (48%), Gaps = 1/72 (1%) Frame = +3 Query: 216 DLLEVSCK-VYKEIKDRIEVDLYIMGDTSYASCCIDSVAAMHVQANGIVHYGHKCFSKTD 392 DLLEV V + + D +EVDL T +SCC D +A G H G+K + Sbjct: 19 DLLEVDLPFVIRGMFDLLEVDLPHQHRTVLSSCCEDVLAIKRTSKIG--HLGNKDHT--- 73 Query: 393 IPVYMVLPKEKL 428 I + PKE+L Sbjct: 74 IFINFNFPKEQL 85 >SB_33893| Best HMM Match : Astacin (HMM E-Value=0.0004) Length = 127 Score = 29.5 bits (63), Expect = 2.1 Identities = 16/53 (30%), Positives = 25/53 (47%) Frame = +3 Query: 354 IVHYGHKCFSKTDIPVYMVLPKEKLDFDAAINTLKEKYDSDDNMKLCLFYGAE 512 ++HYG+ FSK P + + L F A +TL + D ++L Y E Sbjct: 26 VMHYGNTAFSKNGKPTMISIKDPNLQFGATRSTLSD----TDKIQLNALYDCE 74 >SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) Length = 1160 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/30 (36%), Positives = 16/30 (53%), Gaps = 1/30 (3%) Frame = +3 Query: 276 LYIMGDTSYASC-CIDSVAAMHVQANGIVH 362 L GD Y C C D V +HV++ ++H Sbjct: 906 LQFSGDEEYLFCSCTDKVQVLHVESGKVIH 935 >SB_58287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1021 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 402 YMVLPKEKLDFDAAINTLKEKYDSDDNMKLCL 497 + +L +E+ F+ +N L+E+YD + KLC+ Sbjct: 102 FSLLTEERTAFEERLNILQEEYDRVIDEKLCI 133 >SB_42627| Best HMM Match : DUF164 (HMM E-Value=0.33) Length = 412 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = +3 Query: 396 PVYMVLPKEKLDFDAAINTLKEKYDSDDNMKLCLFY 503 P++ L +EK+ D T+ Y +DN + C FY Sbjct: 202 PIFFRLLREKVSLDGEGFTILNMYTPNDNKQQCDFY 237 >SB_39015| Best HMM Match : Lectin_C (HMM E-Value=3.2e-28) Length = 856 Score = 28.3 bits (60), Expect = 5.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 361 IMVTNAFQKLIYQFTWYCQKKN 426 + +T A LIY+FTW KKN Sbjct: 357 VQLTRALNDLIYRFTWLGLKKN 378 >SB_57637| Best HMM Match : SRP40_C (HMM E-Value=2.3e-08) Length = 654 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +3 Query: 252 IKDRIEVDLYIMGDTSYASCCIDSVAAMHVQANGIVHYGHKCFSKT 389 +++ IEVD + ++ A CC+D + ++ + G K +KT Sbjct: 147 VEEEIEVDHRLTDNSFEAKCCLDIIVFSYINRKEPLEIGEKRPTKT 192 >SB_32968| Best HMM Match : SRP40_C (HMM E-Value=0.013) Length = 440 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/46 (26%), Positives = 24/46 (52%) Frame = +3 Query: 252 IKDRIEVDLYIMGDTSYASCCIDSVAAMHVQANGIVHYGHKCFSKT 389 +++ IEVD + ++ A CC+D + ++ + G K +KT Sbjct: 390 VEEEIEVDHRLTDNSFEAKCCLDIIVFSYINRKEPLEIGEKRPTKT 435 >SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1814 Score = 27.9 bits (59), Expect = 6.6 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -1 Query: 131 IVITFSFIYCYLTCYTYFVFCSKIPHFIFDNSFSTYDKKVLT 6 + I F+F+ CY+ C+ F++ DNS S + KV T Sbjct: 1727 LYIYFAFVLCYIPCFAAFLYYG----ITADNSRSGFFVKVTT 1764 >SB_9776| Best HMM Match : 7tm_1 (HMM E-Value=8.2e-08) Length = 409 Score = 27.9 bits (59), Expect = 6.6 Identities = 12/40 (30%), Positives = 22/40 (55%) Frame = +3 Query: 93 REITVNKTEGYDDIITNFDIKETCKWIERKKFAKVCLQFP 212 R + ++ Y ++ +KE K ++ KKF+K CL+ P Sbjct: 319 RHVGISVLHDYGAELSEEKMKEYMKALKTKKFSKFCLRHP 358 >SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) Length = 972 Score = 27.5 bits (58), Expect = 8.7 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -1 Query: 134 YIVITFSFIYCYLTCYTYFVFC 69 Y + + YCY CY Y +C Sbjct: 478 YYCYCYCYYYCYYYCYCYCYYC 499 >SB_23758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 283 Score = 27.5 bits (58), Expect = 8.7 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = +3 Query: 33 KTIVKNKMGNFTTEDKICITREITVNKTEGY 125 +T+V + GN T EDK C+ + + +T Y Sbjct: 194 RTLVPDLYGNLTNEDKACVDNWLDLAQTLHY 224 >SB_10321| Best HMM Match : Urotensin_II (HMM E-Value=6) Length = 200 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 393 YQFLKSICDHNAQFHWPAHA*LPQN 319 Y F +S C+ +FHW + LP N Sbjct: 29 YDFTESYCNERGRFHWTNNNHLPCN 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,944,726 Number of Sequences: 59808 Number of extensions: 377505 Number of successful extensions: 985 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 976 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1434459094 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -