BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10l14 (568 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 25 0.70 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 6.5 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 24.6 bits (51), Expect = 0.70 Identities = 12/34 (35%), Positives = 23/34 (67%) Frame = -3 Query: 149 ANSDRKFLITKIINISNEYNNTTL*IGNVECYSL 48 + + ++ ++T I+ S +YNNT + I +VE Y+L Sbjct: 178 STTGKRNVVTPIVQ-SFDYNNTWVYIADVEGYAL 210 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.4 bits (43), Expect = 6.5 Identities = 9/30 (30%), Positives = 14/30 (46%) Frame = -1 Query: 331 YSWNIL*WKFVSCIADQKTCFTNSTITHNN 242 Y+W+ + + + S A F IT NN Sbjct: 158 YAWSTIDYTYDSIEARDSAIFDGDFITENN 187 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,041 Number of Sequences: 438 Number of extensions: 3497 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -