BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10l11 (607 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g16420.3 68417.m02486 transcriptional adaptor (ADA2b) identic... 32 0.34 At4g16420.1 68417.m02484 transcriptional adaptor (ADA2b) identic... 32 0.34 At2g29500.1 68415.m03583 17.6 kDa class I small heat shock prote... 32 0.34 At5g34500.1 68418.m04033 replication protein-related weak simila... 31 0.45 At5g19860.1 68418.m02361 expressed protein contains Pfam profile... 31 0.78 At4g16420.2 68417.m02485 transcriptional adaptor (ADA2b) identic... 29 2.4 At3g46230.1 68416.m05004 17.4 kDa class I heat shock protein (HS... 29 3.2 At2g42480.1 68415.m05255 meprin and TRAF homology domain-contain... 29 3.2 At1g03530.1 68414.m00334 expressed protein similar to hypothetic... 29 3.2 At2g32370.1 68415.m03956 homeobox-leucine zipper family protein ... 28 4.2 At1g35950.1 68414.m04464 replication protein-related weak simila... 28 4.2 At3g10240.1 68416.m01225 F-box protein-related contains weak Pfa... 28 5.5 At2g46430.1 68415.m05778 cyclic nucleotide-regulated ion channel... 28 5.5 At2g05084.1 68415.m00532 hypothetical protein 28 5.5 At4g11300.1 68417.m01826 expressed protein 27 7.3 At1g55265.1 68414.m06313 expressed protein contains Pfam profile... 27 7.3 At4g16530.1 68417.m02502 expressed protein contains Pfam profile... 27 9.6 At1g55940.1 68414.m06416 cytochrome P450, putative similar to SP... 27 9.6 At1g33420.1 68414.m04137 PHD finger family protein contains Pfam... 27 9.6 >At4g16420.3 68417.m02486 transcriptional adaptor (ADA2b) identical to transcriptional adaptor ADA2b [Arabidopsis thaliana] gi|13591700|gb|AAK31320 Length = 486 Score = 31.9 bits (69), Expect = 0.34 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +3 Query: 132 RELFGPQDFYRMSPFNQSMHRDRYRMSPYNQFRDVFEPQFYRPWENTLRQIE 287 +E F + F P + S++ +S YNQ R+ F+P++ E L ++E Sbjct: 204 KESFVDRSFGGKKPVSTSVNNSLVELSNYNQKREEFDPEYDNDAEQLLAEME 255 >At4g16420.1 68417.m02484 transcriptional adaptor (ADA2b) identical to transcriptional adaptor ADA2b [Arabidopsis thaliana] gi|13591700|gb|AAK31320 Length = 487 Score = 31.9 bits (69), Expect = 0.34 Identities = 15/52 (28%), Positives = 27/52 (51%) Frame = +3 Query: 132 RELFGPQDFYRMSPFNQSMHRDRYRMSPYNQFRDVFEPQFYRPWENTLRQIE 287 +E F + F P + S++ +S YNQ R+ F+P++ E L ++E Sbjct: 205 KESFVDRSFGGKKPVSTSVNNSLVELSNYNQKREEFDPEYDNDAEQLLAEME 256 >At2g29500.1 68415.m03583 17.6 kDa class I small heat shock protein (HSP17.6B-CI) contains Pfam PF00011: Hsp20/alpha crystallin family; identified in Scharf, K-D., et al, Cell Stress & Chaperones (2001) 6: 225-237. Length = 153 Score = 31.9 bits (69), Expect = 0.34 Identities = 16/34 (47%), Positives = 22/34 (64%) Frame = +3 Query: 501 SRQFIRRYALPQGCLPDTVESKLSSDGVLTVTAP 602 S QF RR+ LP+ D V++ + +GVLTVT P Sbjct: 105 SGQFTRRFRLPENVKMDQVKAAM-ENGVLTVTVP 137 >At5g34500.1 68418.m04033 replication protein-related weak similarity to Replication Protein A 70 kDa DNA-binding subunit (RP-A) (RF-A) (Replication factor-A protein 1) (Single-stranded DNA-binding protein) (DMRPA1) (GI:2498844)(SP:Q24492) [Drosophila melanogaster] Length = 156 Score = 31.5 bits (68), Expect = 0.45 Identities = 21/46 (45%), Positives = 25/46 (54%) Frame = -1 Query: 154 SCGPKSSRSIRRNGLSKSYTYGKIDIVFC*FATSSFYKIQALISEY 17 +C S+ R G+ KSY Y I IV F TS F +ALISEY Sbjct: 86 ACESFLSKFYRLIGI-KSYNYEPITIVLRFFRTSMFKGSKALISEY 130 >At5g19860.1 68418.m02361 expressed protein contains Pfam profile PF04398: Protein of unknown function, DUF538 Length = 181 Score = 30.7 bits (66), Expect = 0.78 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 507 QFIRRYALPQGCLPDTV-ESKLSSDGVLTVTAP 602 + + +Y LP G LPDTV + LS DG V P Sbjct: 38 ELLPKYGLPSGLLPDTVTDFTLSDDGRFVVHLP 70 >At4g16420.2 68417.m02485 transcriptional adaptor (ADA2b) identical to transcriptional adaptor ADA2b [Arabidopsis thaliana] gi|13591700|gb|AAK31320 Length = 483 Score = 29.1 bits (62), Expect = 2.4 Identities = 13/46 (28%), Positives = 24/46 (52%) Frame = +3 Query: 150 QDFYRMSPFNQSMHRDRYRMSPYNQFRDVFEPQFYRPWENTLRQIE 287 + F P + S++ +S YNQ R+ F+P++ E L ++E Sbjct: 207 RSFGGKKPVSTSVNNSLVELSNYNQKREEFDPEYDNDAEQLLAEME 252 >At3g46230.1 68416.m05004 17.4 kDa class I heat shock protein (HSP17.4-CI) identical to 17.4 kDa class I heat shock protein SP:P19036 from [Arabidopsis thaliana] Length = 156 Score = 28.7 bits (61), Expect = 3.2 Identities = 13/34 (38%), Positives = 23/34 (67%) Frame = +3 Query: 501 SRQFIRRYALPQGCLPDTVESKLSSDGVLTVTAP 602 S +F+RR+ LP+ + V++ + +GVL+VT P Sbjct: 108 SGKFMRRFRLPENAKVEEVKASM-ENGVLSVTVP 140 >At2g42480.1 68415.m05255 meprin and TRAF homology domain-containing protein / MATH domain-containing protein similar to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 743 Score = 28.7 bits (61), Expect = 3.2 Identities = 20/92 (21%), Positives = 43/92 (46%), Gaps = 4/92 (4%) Frame = +3 Query: 135 ELFGPQDFYRMSPFNQSMHRDRYRMSPYNQFRDVFEPQ---FYRPWENTLRQIENVMKPI 305 E+ G QD+ + F S+ R + + + + F+P+ F + + N LR + + Sbjct: 154 EIIGSQDYASQASFKGSVTLVRKIFAEHPEIAEEFKPKNQVFKKEYMNILRNAYRKVSEL 213 Query: 306 EQLTSAMNQMALQEMGSKITS-NDEKFQVNID 398 ++ + ++E+ +I NDE +V +D Sbjct: 214 AEVKMDWVKSKIEEVSLEIKKRNDEVSEVPLD 245 >At1g03530.1 68414.m00334 expressed protein similar to hypothetical protein GB:O14360 Length = 797 Score = 28.7 bits (61), Expect = 3.2 Identities = 17/81 (20%), Positives = 31/81 (38%) Frame = +3 Query: 162 RMSPFNQSMHRDRYRMSPYNQFRDVFEPQFYRPWENTLRQIENVMKPIEQLTSAMNQMAL 341 +M P MHR + +M+P Q F+P P + + P Q + Sbjct: 677 QMHPPQSQMHRPQSQMNPQFQMPPQFQPHQQSPMNPQYQMMHRPQSPANPQFQMQAQSDV 736 Query: 342 QEMGSKITSNDEKFQVNIDVQ 404 + + S+I + Q ++ Q Sbjct: 737 RPLQSQIPQSPSDLQSPMEPQ 757 >At2g32370.1 68415.m03956 homeobox-leucine zipper family protein / lipid-binding START domain-containing protein similar to HD-Zip homeo domain OCL5 protein (GI:8920427) [Zea mays]; contains Pfam PF00046: Homeobox domain and Pfam PF01852: START domain Length = 721 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +2 Query: 278 TNRKRNETDRAADFGDESNGASGDGL*NHIQRREVSGQYRRTT 406 TN + D+ D G+ S+G G+GL N+ R +Y R T Sbjct: 34 TNAGNDSGDQDFDSGNTSSGNHGEGLGNNQAPRHKKKKYNRHT 76 >At1g35950.1 68414.m04464 replication protein-related weak similarity to Replication Protein A 70 kDa DNA-binding subunit (RP-A) (RF-A) (Replication factor-A protein 1) (Single-stranded DNA-binding protein) (DMRPA1) (GI:2498844)(SP:Q24492) [Drosophila melanogaster] Length = 231 Score = 28.3 bits (60), Expect = 4.2 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -1 Query: 109 SKSYTYGKIDIVFC*FATSSFYKIQALISEY 17 SK+Y Y + V F TS F +ALISEY Sbjct: 173 SKTYNYEPLTTVLRFFRTSMFKGSKALISEY 203 >At3g10240.1 68416.m01225 F-box protein-related contains weak Pfam:PF00646 F-box domain Length = 389 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/41 (36%), Positives = 23/41 (56%), Gaps = 4/41 (9%) Frame = -3 Query: 326 HRRSQLLDRFHYVFYLSQSIFPGSVKLR----FKDVAKLIV 216 H SQL+DR+H F + FP + + F++ A+LIV Sbjct: 103 HSYSQLIDRYHMEFSEEMNYFPPTESVNGLICFQESARLIV 143 >At2g46430.1 68415.m05778 cyclic nucleotide-regulated ion channel / cyclic nucleotide-gated channel (CNGC3) identical to cyclic nucleotide and calmodulin-regulated ion channel GI:4581201 from [Arabidopsis thaliana] Length = 706 Score = 27.9 bits (59), Expect = 5.5 Identities = 16/72 (22%), Positives = 37/72 (51%), Gaps = 2/72 (2%) Frame = -3 Query: 437 YLHIYFIR*KMLYVDIDLKLLVVGCDFRAHLLKRHLIHRRSQLLDRFH--YVFYLSQSIF 264 + +I +++ + +++D KL + C FR + +++H +L +FH ++ S Sbjct: 101 FFYIPYVKPERFCLNLDKKLQTIACVFRTFIDAFYVVH----MLFQFHTGFITPSSSGFG 156 Query: 263 PGSVKLRFKDVA 228 G + + KD+A Sbjct: 157 RGELNEKHKDIA 168 >At2g05084.1 68415.m00532 hypothetical protein Length = 258 Score = 27.9 bits (59), Expect = 5.5 Identities = 15/31 (48%), Positives = 17/31 (54%) Frame = -1 Query: 109 SKSYTYGKIDIVFC*FATSSFYKIQALISEY 17 SK Y Y + V F TS F +ALISEY Sbjct: 198 SKGYNYEPLTTVLRFFRTSMFKGSKALISEY 228 >At4g11300.1 68417.m01826 expressed protein Length = 371 Score = 27.5 bits (58), Expect = 7.3 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 6/58 (10%) Frame = +2 Query: 197 PLQNVSVQSISRRL*TAVLQTL------GKYFATNRKRNETDRAADFGDESNGASGDG 352 PL + SV+ R L T++L L G + +R+ TD+ + FG S G+SG G Sbjct: 143 PLSDGSVRRAKRAL-TSLLAALNADKNSGSSGGGSGRRSSTDQWSSFGRRSGGSSGGG 199 >At1g55265.1 68414.m06313 expressed protein contains Pfam profile PF04398: Protein of unknown function, DUF538 Length = 175 Score = 27.5 bits (58), Expect = 7.3 Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Frame = +3 Query: 519 RYALPQGCLPDTVES-KLSSDGVLTV 593 RY P+G LP+ V+S +S DG TV Sbjct: 60 RYGFPKGLLPNNVKSYTISDDGDFTV 85 >At4g16530.1 68417.m02502 expressed protein contains Pfam profile PF04510: Family of unknown function (DUF577) Length = 774 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/43 (41%), Positives = 25/43 (58%) Frame = -1 Query: 154 SCGPKSSRSIRRNGLSKSYTYGKIDIVFC*FATSSFYKIQALI 26 S G RSI + LS++ TY K IVF F+ S Y+I+ L+ Sbjct: 69 SSGILRLRSISQ--LSETLTYLKNQIVFSKFSLDSLYEIKPLL 109 >At1g55940.1 68414.m06416 cytochrome P450, putative similar to SP:Q42569 from [Arabidopsis thaliana] Length = 639 Score = 27.1 bits (57), Expect = 9.6 Identities = 18/73 (24%), Positives = 34/73 (46%) Frame = +3 Query: 165 MSPFNQSMHRDRYRMSPYNQFRDVFEPQFYRPWENTLRQIENVMKPIEQLTSAMNQMALQ 344 + P +S + +R ++ R F+P F+ N L NVMK ++++ + Sbjct: 339 IKPETKSKLIESFRDFSFDLVRSPFDPSFWNALYNGLMARSNVMKMLKRM--------FK 390 Query: 345 EMGSKITSNDEKF 383 E + TS+D K+ Sbjct: 391 ERREEATSDDSKY 403 >At1g33420.1 68414.m04137 PHD finger family protein contains Pfam profile: PF00628: PHD-finger Length = 697 Score = 27.1 bits (57), Expect = 9.6 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = -1 Query: 415 GEKCCTSILT*NFSSLDVILEPIS*SAI*FIAEVSCSIGFITFSICRK 272 G+ S L+ SLDV+ E ++ S+ E C +G+ + +CRK Sbjct: 79 GDSTDGSDLSSKLVSLDVVEEDVTRSSRSVYCEHCCVVGWSSHPVCRK 126 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,240,619 Number of Sequences: 28952 Number of extensions: 233787 Number of successful extensions: 748 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 739 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 748 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1206913392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -