BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10l10 (556 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35644| Best HMM Match : Ribosomal_L41 (HMM E-Value=9.6) 42 3e-04 SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) 29 2.6 >SB_35644| Best HMM Match : Ribosomal_L41 (HMM E-Value=9.6) Length = 117 Score = 42.3 bits (95), Expect = 3e-04 Identities = 18/36 (50%), Positives = 24/36 (66%) Frame = +3 Query: 213 ACITKIHREVYSRMYYPTTIALPDGSTINVRYHEPR 320 A IT++ ++ Y RMY + PDGST +RYHEPR Sbjct: 29 ASITRLKKQAYPRMY-KVLVVQPDGSTYTMRYHEPR 63 >SB_21169| Best HMM Match : zf-CHY (HMM E-Value=2.1e-09) Length = 2059 Score = 29.1 bits (62), Expect = 2.6 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +1 Query: 334 CH*IYHCCLKMKEKHGWRNESPRRRSRLLKI*EIVSMQ 447 CH ++ CCLK H NES R L K + + ++ Sbjct: 1861 CHVMFPCCLKFFPCHRCHNESKECRESLRKAKDAIRLR 1898 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,603,747 Number of Sequences: 59808 Number of extensions: 202790 Number of successful extensions: 351 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 351 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1288581898 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -