BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10l08 (479 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal prote... 87 6e-18 U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical pr... 27 7.0 AF016682-8|AAO38605.1| 422|Caenorhabditis elegans Hypothetical ... 27 9.3 >U53148-5|AAB37076.1| 130|Caenorhabditis elegans Ribosomal protein, small subunitprotein 30 protein. Length = 130 Score = 87.0 bits (206), Expect = 6e-18 Identities = 41/63 (65%), Positives = 47/63 (74%) Frame = +2 Query: 236 LLGGKVHGSLARAGKVKGQTPKVEXXXXXXXXTGRAKRRIQYNRRFVNVVQTFGRRRGPN 415 LLGGKVHGSLARAGKV+ QTPKV+ GRA RR+QY RR+VNV G++RGPN Sbjct: 68 LLGGKVHGSLARAGKVRAQTPKVDKQDKKKKKRGRAFRRVQYTRRYVNVASGPGKKRGPN 127 Query: 416 SNS 424 SNS Sbjct: 128 SNS 130 >U41541-3|AAK18894.1| 7829|Caenorhabditis elegans Hypothetical protein C41A3.1 protein. Length = 7829 Score = 27.1 bits (57), Expect = 7.0 Identities = 10/22 (45%), Positives = 10/22 (45%) Frame = +3 Query: 27 FTICSCISEGNRHTSWTSMARS 92 F I C G HT WT RS Sbjct: 4931 FIIICCFENGTSHTEWTGTLRS 4952 >AF016682-8|AAO38605.1| 422|Caenorhabditis elegans Hypothetical protein T07D3.9b protein. Length = 422 Score = 26.6 bits (56), Expect = 9.3 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 1/42 (2%) Frame = -1 Query: 146 LHRQLQQEYECVP*SDQWTPGH*R-PGRVSIAL*YATAYCKI 24 LH ++E EC P + H + PGR S A YA C+I Sbjct: 375 LHDGKRRESECAPCGSKALCAHHKLPGRTSAAEQYAEKNCEI 416 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,650,003 Number of Sequences: 27780 Number of extensions: 161392 Number of successful extensions: 334 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 334 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 882200194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -