BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10l07 (656 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38771| Best HMM Match : No HMM Matches (HMM E-Value=.) 100 9e-22 SB_56680| Best HMM Match : PTR2 (HMM E-Value=3e-06) 29 4.4 SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) 28 5.8 SB_24373| Best HMM Match : Skb1 (HMM E-Value=1.6e-05) 28 5.8 >SB_38771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 267 Score = 100 bits (240), Expect = 9e-22 Identities = 53/120 (44%), Positives = 78/120 (65%), Gaps = 1/120 (0%) Frame = +3 Query: 117 LEANAKEFDSVLKLYPQAIKLKAERKTK-RPDELIKLDNWYQNELPKKIKSRGKDAHMIH 293 L+A+A + VL LY +K A+ K K + ++L++LDNW+Q ELP I SR ++ ++ Sbjct: 5 LDASAVRWHEVLDLYGVVVKEMAKGKKKDKAEQLLELDNWFQQELPVSISSR-EEKYLTK 63 Query: 294 EELVQLMKWKQARGKFYPQLSYLIKVNTPRAVMQETKKAFRKLPNIESAMTALSNLKGVG 473 +EL +LM WK +RGKF P+L LIK N+ + TKKAF+ LP++ A+ LS L GVG Sbjct: 64 DELTKLMTWKLSRGKFRPRLVDLIKSNSDDKIDTLTKKAFKLLPDVIQAIKVLSELNGVG 123 >SB_56680| Best HMM Match : PTR2 (HMM E-Value=3e-06) Length = 606 Score = 28.7 bits (61), Expect = 4.4 Identities = 23/65 (35%), Positives = 31/65 (47%) Frame = -2 Query: 472 PTPLRLLRAVIADSILGSLRKAFFVSCITARGVFTFIRYDNCG*NFPLACFHFMSWTSSS 293 P LR+ R IA IL + + F IT V F+ DN G + A + +TS + Sbjct: 48 PRKLRMRRLPIACLILAEVCERFAYYGITINFVL-FL--DNFGWSMFAAAGGVLVYTSVA 104 Query: 292 WIMCA 278 W MCA Sbjct: 105 WFMCA 109 >SB_10690| Best HMM Match : Pkinase (HMM E-Value=6.4e-08) Length = 865 Score = 28.3 bits (60), Expect = 5.8 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = +2 Query: 359 SDKSEHATSCDARDEKGLPQTAQYRIRDDRSKQSQRRGNGH 481 S K EH + +RD+K P++ R R R +SQ RG + Sbjct: 150 SRKREHRSRSKSRDKKPKPESPS-RGRSSRRSRSQERGTSN 189 >SB_24373| Best HMM Match : Skb1 (HMM E-Value=1.6e-05) Length = 494 Score = 28.3 bits (60), Expect = 5.8 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 168 AIKLKAERKTKRPDELIKLDNWYQ 239 ++K K ER R D+LIKL WY+ Sbjct: 426 SLKRKLERVRDREDKLIKLKLWYE 449 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,117,568 Number of Sequences: 59808 Number of extensions: 438884 Number of successful extensions: 1155 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1154 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1681430875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -