BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10l06 (599 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_01_0178 - 2548611-2548670,2549816-2549918,2549993-2550096,255... 32 0.40 03_04_0127 - 17508808-17509029,17509195-17509938,17510004-175102... 30 1.2 02_05_0959 + 33086498-33086544,33087295-33087967,33088665-330890... 30 1.6 06_01_0692 - 5047162-5047441,5047602-5047726,5048257-5048327,504... 29 2.2 05_04_0206 + 19034259-19035462,19036870-19037045,19037752-190379... 29 2.2 02_05_0556 - 29940146-29940158,29941060-29941240,29941271-29941670 29 2.2 08_02_1437 - 27096364-27097252,27098931-27099022,27099382-270996... 29 2.8 10_07_0138 + 13325418-13325954 29 3.8 01_06_0213 + 27580635-27581105,27581206-27581298,27581376-275815... 28 5.0 06_03_1158 - 28080330-28080647,28080726-28080949,28081213-280814... 27 8.7 03_04_0122 + 17465804-17465893,17466028-17466147,17466287-174663... 27 8.7 02_04_0039 - 19118632-19118820,19119018-19119395,19120151-191203... 27 8.7 02_04_0035 + 19078267-19078479,19078588-19078674,19079792-190798... 27 8.7 >09_01_0178 - 2548611-2548670,2549816-2549918,2549993-2550096, 2550893-2550988,2551418-2551482,2551558-2551591, 2552469-2552540,2552567-2552644,2553416-2553477, 2554267-2554530,2555057-2555246,2555432-2555500, 2555613-2555669,2555746-2555846,2556029-2556146, 2556225-2556272,2556362-2556487,2556960-2557118, 2558119-2558216,2558324-2558416,2559741-2559937, 2560231-2560354,2561121-2561334,2561773-2561830, 2561955-2562433 Length = 1022 Score = 31.9 bits (69), Expect = 0.40 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 410 PRVEEPPPTTASVPPDVSPTADSWEVE 490 PRVE PPP+ A+ PP + P D + E Sbjct: 62 PRVEGPPPSPATAPPMLHPREDDEDEE 88 >03_04_0127 - 17508808-17509029,17509195-17509938,17510004-17510242, 17510334-17510436,17510666-17510770,17510838-17510906, 17510998-17511402,17512048-17512156,17512240-17512295 Length = 683 Score = 30.3 bits (65), Expect = 1.2 Identities = 13/25 (52%), Positives = 15/25 (60%) Frame = +2 Query: 101 LRSATIMSNNGAPDSWENEAEIIGE 175 L I +NN AP SW N +IIGE Sbjct: 397 LEDRIICTNNSAPLSWYNRTQIIGE 421 >02_05_0959 + 33086498-33086544,33087295-33087967,33088665-33089058, 33089140-33089210,33089373-33089497,33089705-33089821, 33094128-33094238,33094321-33094413,33094726-33094984, 33095067-33095189 Length = 670 Score = 29.9 bits (64), Expect = 1.6 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%) Frame = +2 Query: 176 KGAKDSNDVSSKISTLNVNAMEFVPS-FSKP 265 KG + + S ++TLN NA EFVPS F P Sbjct: 29 KGGDAGSKLPSTVTTLNPNAAEFVPSTFRSP 59 >06_01_0692 - 5047162-5047441,5047602-5047726,5048257-5048327, 5048453-5048834,5049389-5050126 Length = 531 Score = 29.5 bits (63), Expect = 2.2 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +2 Query: 206 SKISTLNVNAMEFVPSFSKPSQASDS 283 +K++ LN NA EFVPS +PS S + Sbjct: 19 NKVTALNPNAAEFVPSCIRPSFESSA 44 >05_04_0206 + 19034259-19035462,19036870-19037045,19037752-19037975, 19038133-19038914,19039337-19039494 Length = 847 Score = 29.5 bits (63), Expect = 2.2 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = +2 Query: 410 PRVEEPPPTTASVPPDVSPTADSWE 484 P +PPP PPD P D+W+ Sbjct: 213 PVTPQPPPPPPPPPPDSKPGVDTWD 237 >02_05_0556 - 29940146-29940158,29941060-29941240,29941271-29941670 Length = 197 Score = 29.5 bits (63), Expect = 2.2 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = +2 Query: 416 VEEPPPTTASVPPDVSPTADSWEVEAD 496 ++EPPP A P S TA W ++AD Sbjct: 5 IDEPPPAPAPPQPKQSTTARRWWMKAD 31 >08_02_1437 - 27096364-27097252,27098931-27099022,27099382-27099654, 27099872-27100819 Length = 733 Score = 29.1 bits (62), Expect = 2.8 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = +2 Query: 137 PDSWENEAEIIGEKGAKDSNDVSSKISTLNVNAMEFVPSFSKPSQASDSTDSPTS 301 P N AEI + K ++ +S + ++ E V S +KP+ A + SPTS Sbjct: 158 PSVKNNGAEIKKPQLTKSNSSLSKQALNSIIDKKEVVSSKTKPTSARSTPSSPTS 212 >10_07_0138 + 13325418-13325954 Length = 178 Score = 28.7 bits (61), Expect = 3.8 Identities = 11/19 (57%), Positives = 11/19 (57%) Frame = -2 Query: 454 GRDRCSSRWWFFNTWRSRC 398 G RCS RW WRSRC Sbjct: 83 GARRCSRRWRRSRRWRSRC 101 >01_06_0213 + 27580635-27581105,27581206-27581298,27581376-27581540, 27581640-27581862,27582329-27582429,27582666-27582713, 27583086-27583172,27583745-27583879,27583985-27584140, 27585336-27585545,27585641-27586351,27586429-27586974, 27587872-27588495,27588595-27588699,27590460-27590711, 27590939-27591766 Length = 1584 Score = 28.3 bits (60), Expect = 5.0 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 176 KGAKDSNDVSSKISTLNVNAMEFV-PSFSKPSQASDSTDSP 295 K K+ D ++ S L + E PS KPS A+ S+DSP Sbjct: 692 KREKEKVDALTQSSDLTTSGKEAPKPSLGKPSSANTSSDSP 732 >06_03_1158 - 28080330-28080647,28080726-28080949,28081213-28081423, 28081536-28081708,28082093-28082156,28082353-28082514 Length = 383 Score = 27.5 bits (58), Expect = 8.7 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = -2 Query: 310 FLGGGRGIGTIASLRRLRKRRHEFHGIYIQRGNF*RHIIRILCTFFTYY 164 F GG + +R + H+ H IY+ G++ H++R +FF Y Sbjct: 84 FTGGSHSLMGKELVREITDLAHK-HDIYVSTGDWAEHLLRQGPSFFKQY 131 >03_04_0122 + 17465804-17465893,17466028-17466147,17466287-17466317, 17466978-17467153,17468051-17468142,17468259-17468340, 17468498-17468566,17468655-17468759,17471246-17471342, 17471438-17471676,17472191-17472949,17473079-17473297 Length = 692 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +2 Query: 101 LRSATIMSNNGAPDSWENEAEIIGE 175 L + +NN P W+N +IIGE Sbjct: 403 LEDHIVCANNSTPLPWQNRTQIIGE 427 >02_04_0039 - 19118632-19118820,19119018-19119395,19120151-19120345, 19120425-19120502,19120567-19120752,19120828-19121058, 19121137-19121490,19121588-19121785,19121869-19122039, 19122156-19122263,19122362-19122580,19122665-19122871, 19122978-19123196,19123315-19123389,19123749-19123901 Length = 986 Score = 27.5 bits (58), Expect = 8.7 Identities = 18/70 (25%), Positives = 33/70 (47%), Gaps = 1/70 (1%) Frame = +2 Query: 101 LRSATIMSNNGAPDSWENEAEIIGEKGAKDSNDVSSKISTLNVNAMEFVP-SFSKPSQAS 277 ++ +++ A +SW + G +GA S D ++ ++ E VP S +P+ S Sbjct: 779 VKGEIVLAQFSADNSWNRAMIVNGPRGAVSSQDDKFEVFYIDYGNQEVVPYSRIRPADPS 838 Query: 278 DSTDSPTSPQ 307 S+ SP Q Sbjct: 839 ISS-SPALAQ 847 >02_04_0035 + 19078267-19078479,19078588-19078674,19079792-19079863, 19080338-19080526,19080599-19080718,19081348-19081430, 19081518-19081773,19081878-19082199,19086355-19086548, 19087135-19087227,19089327-19089497,19089580-19089699, 19090303-19090373,19090608-19090675,19091097-19091191 Length = 717 Score = 27.5 bits (58), Expect = 8.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 301 GGRGIGTIASLRRLRKRR 248 GGRG+GT+ RR KR+ Sbjct: 503 GGRGVGTVEEARRKEKRK 520 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,347,241 Number of Sequences: 37544 Number of extensions: 242871 Number of successful extensions: 1153 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1061 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1146 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1435654836 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -