BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10l05 (526 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_896| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.2 SB_11070| Best HMM Match : Sugar_tr (HMM E-Value=0.00011) 27 9.5 >SB_896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 968 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +3 Query: 15 YLSLVVIAFVRSRKMGG--QRFFWSSVGIILFTSSYYV 122 Y+ ++ + ++R M G Q FFW I+ FT +Y++ Sbjct: 700 YVYVIELVGPKARTMSGKVQDFFWDLGDILSFTCAYFI 737 >SB_11070| Best HMM Match : Sugar_tr (HMM E-Value=0.00011) Length = 468 Score = 27.1 bits (57), Expect = 9.5 Identities = 11/38 (28%), Positives = 22/38 (57%), Gaps = 2/38 (5%) Frame = +3 Query: 15 YLSLVVIAFVRSRKMGG--QRFFWSSVGIILFTSSYYV 122 Y+ ++ + ++R M G Q FFW ++ FT +Y++ Sbjct: 187 YVYVIELVGPKARTMSGKVQDFFWDLGDVLSFTCAYFI 224 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,084,751 Number of Sequences: 59808 Number of extensions: 162918 Number of successful extensions: 339 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 325 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 339 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1184975377 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -