BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10k21 (653 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory recept... 24 1.3 AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory recept... 22 3.8 AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 22 5.1 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 21 6.7 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 6.7 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 6.7 >AM292378-1|CAL23190.2| 387|Tribolium castaneum gustatory receptor candidate 57 protein. Length = 387 Score = 23.8 bits (49), Expect = 1.3 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +1 Query: 175 FNTDISTKLENSRNTLRKIARNDGAEFSKQSILNDMEK 288 FN + L S+ + K N G E SKQ I N K Sbjct: 73 FNVSLRIILVFSKGKVIKSFFNQGYELSKQEIFNCCSK 110 >AM292380-1|CAL23192.2| 489|Tribolium castaneum gustatory receptor candidate 59 protein. Length = 489 Score = 22.2 bits (45), Expect = 3.8 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = +2 Query: 236 VMMVLNFQNRAS*MTWRNLSKWL 304 + LNF + TWR L +W+ Sbjct: 146 ISFFLNFMLHCNNTTWRCLYRWI 168 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 21.8 bits (44), Expect = 5.1 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = +1 Query: 238 NDGAEFSKQSILNDMEKFVKMVNTMDETVLVPSRLMNLPQ 357 NDG ++N +F V + TV VP+ + Q Sbjct: 237 NDGDNKPDTILVNGFGRFKHFVGADNSTVFVPTARFTVEQ 276 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 223 RKIARNDGAEFSKQSILNDMEK 288 +++A + AE K+ LND+EK Sbjct: 59 KELAEKEEAETLKRYKLNDLEK 80 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 223 RKIARNDGAEFSKQSILNDMEK 288 +++A + AE K+ LND+EK Sbjct: 219 KELAEKEEAETLKRYKLNDLEK 240 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 6.7 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 223 RKIARNDGAEFSKQSILNDMEK 288 +++A + AE K+ LND+EK Sbjct: 219 KELAEKEEAETLKRYKLNDLEK 240 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 146,914 Number of Sequences: 336 Number of extensions: 3105 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16865010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -