BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10k19 (643 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 ... 25 0.53 AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax pr... 22 3.7 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 21 6.5 >AJ223614-1|CAA11490.1| 301|Tribolium castaneum orthodenticle-2 protein protein. Length = 301 Score = 25.0 bits (52), Expect = 0.53 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +1 Query: 136 HFYVQSGSEGERRRNQVLETLTKTSPGPV 222 H QS + + +N+ LTKTSP PV Sbjct: 131 HNQQQSVEKSSKLKNKSAPILTKTSPTPV 159 >AY074761-1|AAL71874.1| 314|Tribolium castaneum ultrabithorax protein. Length = 314 Score = 22.2 bits (45), Expect = 3.7 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +3 Query: 492 HHDLKKKLPRSRSPADLAHRDVSQLSVSDGVTNDGHS 602 HH L+ + P+ SP D + +L S+G N +S Sbjct: 55 HHHLQARPPQD-SPYDASVAAACKLYSSEGQQNSNYS 90 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 21.4 bits (43), Expect = 6.5 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +3 Query: 420 WVYVIVAESRREGFIPH 470 W+ I+ + R EG+I H Sbjct: 352 WIDAIMTQLREEGWIHH 368 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 151,222 Number of Sequences: 336 Number of extensions: 3310 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 16448590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -