BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10k18 (609 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.0 AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory recept... 21 6.1 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 6.1 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 21 6.1 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 21 8.1 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.0 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = -3 Query: 307 LLLWCLNSLTLHSLVC*CIF 248 L L CL+ TLH L CI+ Sbjct: 194 LFLLCLDYFTLHLLFLPCIY 213 >AM292375-1|CAL23187.2| 311|Tribolium castaneum gustatory receptor candidate 54 protein. Length = 311 Score = 21.4 bits (43), Expect = 6.1 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = -3 Query: 214 LSNFGFLIPSLLNIPTPWHEDLRSTRSSPKLLFKLSPFYEEE 89 LS F + + S++ I ++R + ++ +KL FY EE Sbjct: 215 LSVFVYTLVSVILIIMGCDVVASNSRKTAEMCYKLQGFYPEE 256 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 21.4 bits (43), Expect = 6.1 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +2 Query: 2 KMYLSMFFLFLSIGYLI 52 K Y FFL LSIG ++ Sbjct: 33 KFYAVAFFLALSIGVVV 49 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 21.4 bits (43), Expect = 6.1 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = -3 Query: 547 SLEKLVPACGIRTPVQRYIRMHRTSY 470 S+ +L+P + ++ Y MH+ Y Sbjct: 371 SINRLLPTAESKADIKMYADMHQYGY 396 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 21.0 bits (42), Expect = 8.1 Identities = 9/21 (42%), Positives = 11/21 (52%) Frame = -1 Query: 162 GMKIFALRVHLPNYFLNYRHF 100 G IF R P Y+L + HF Sbjct: 653 GYVIFRFRADNPGYWLFHCHF 673 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,864 Number of Sequences: 336 Number of extensions: 3072 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15457268 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -