BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10k17 (506 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g04920.1 68416.m00534 40S ribosomal protein S24 (RPS24A) simi... 170 4e-43 At5g28060.1 68418.m03382 40S ribosomal protein S24 (RPS24B) 40S ... 166 9e-42 At5g07570.1 68418.m00867 glycine/proline-rich protein contains s... 29 1.4 At5g26850.1 68418.m03203 expressed protein 28 4.2 At5g52700.1 68418.m06542 heavy-metal-associated domain-containin... 27 5.5 At5g23040.2 68418.m02694 expressed protein similar to unknown pr... 27 5.5 At5g23040.1 68418.m02693 expressed protein similar to unknown pr... 27 5.5 At1g48250.1 68414.m05388 hypothetical protein 27 7.3 At2g07715.1 68415.m00965 ribosomal protein L2, putative similar ... 27 9.6 >At3g04920.1 68416.m00534 40S ribosomal protein S24 (RPS24A) similar to ribosomal protein S19 GB:445612 [Solanum tuberosum] and similar to ribosomal protein S24 GB:4506703 [Homo sapiens] Length = 133 Score = 170 bits (414), Expect = 4e-43 Identities = 81/121 (66%), Positives = 99/121 (81%), Gaps = 1/121 (0%) Frame = +2 Query: 68 MSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVT-PDVVFVF 244 M+E TIRTRKFMTNRLL+RKQ V DVLHPG+ VSK E++EKLA+MY+V P+ +FVF Sbjct: 1 MAEKAVTIRTRKFMTNRLLSRKQFVIDVLHPGRANVSKAELKEKLARMYEVKDPNAIFVF 60 Query: 245 GFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVR 424 F+T+FGGGKS+GF LIYDT++ AKKFEPK+RL R+GL K +RKQ KERKNR KK+R Sbjct: 61 KFRTHFGGGKSSGFGLIYDTVESAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIR 120 Query: 425 G 427 G Sbjct: 121 G 121 >At5g28060.1 68418.m03382 40S ribosomal protein S24 (RPS24B) 40S ribosomal protein S19, Cyanophora paradoxa, EMBL:CPA245654 Length = 133 Score = 166 bits (403), Expect = 9e-42 Identities = 79/121 (65%), Positives = 97/121 (80%), Gaps = 1/121 (0%) Frame = +2 Query: 68 MSEGTATIRTRKFMTNRLLARKQMVCDVLHPGKPTVSKTEIREKLAKMYKVT-PDVVFVF 244 M+E TIRTR FMTNRLLARKQ V DVLHPG+ VSK E++EKLA+MY+V P+ +F F Sbjct: 1 MAEKAVTIRTRNFMTNRLLARKQFVIDVLHPGRANVSKAELKEKLARMYEVKDPNAIFCF 60 Query: 245 GFKTNFGGGKSTGFALIYDTLDLAKKFEPKHRLARHGLYEKKRPTRKQRKERKNRMKKVR 424 F+T+FGGGKS+G+ LIYDT++ AKKFEPK+RL R+GL K +RKQ KERKNR KK+R Sbjct: 61 KFRTHFGGGKSSGYGLIYDTVENAKKFEPKYRLIRNGLDTKIEKSRKQIKERKNRAKKIR 120 Query: 425 G 427 G Sbjct: 121 G 121 >At5g07570.1 68418.m00867 glycine/proline-rich protein contains similarity to flagelliform silk protein [Nephila clavipes] gi|7106224|gb|AAF36090 Length = 1504 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 227 DVVFVFGFKTNFGGGKSTGFALIYDT 304 DV FV GF T+F G GFA+ + T Sbjct: 251 DVGFVVGFVTSFAAGLDVGFAIDFAT 276 Score = 27.9 bits (59), Expect = 4.2 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 236 FVFGFKTNFGGGKSTGFALIYDT 304 FV GF T+F G TGF + +DT Sbjct: 110 FVTGFATDFDVGFDTGFTIGFDT 132 >At5g26850.1 68418.m03203 expressed protein Length = 919 Score = 27.9 bits (59), Expect = 4.2 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +2 Query: 107 MTNRLLARKQMVCDVLHPGKPTVSKTEIRE-KLAKMYKVTPDVVFVFGFKTN 259 M +++ ++ D++ P +SK E + K+ + + TPD F+FG + N Sbjct: 702 MRSKVELSNTIITDIVAKNLPKLSKLEEADVKMQILEQFTPDDAFMFGSRPN 753 >At5g52700.1 68418.m06542 heavy-metal-associated domain-containing protein contains Pfam profile PF00403: Heavy-metal-associated domain Length = 370 Score = 27.5 bits (58), Expect = 5.5 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 1/54 (1%) Frame = +1 Query: 277 NWIRFDLRHTRSGQEVRAQAQVSPPRPVR-EEEAHAQTA*RT*EQNEEGPRYQE 435 N F++++ S V A+ +V PP PVR +A + Q E P Y++ Sbjct: 202 NGTNFNMKNALSSFRVPARVRVPPPPPVRPASPVYAAGRGKKFNQGNEFPTYKQ 255 >At5g23040.2 68418.m02694 expressed protein similar to unknown protein (emb|CAB62636.1) Length = 258 Score = 27.5 bits (58), Expect = 5.5 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 124 QQSVGHELASANSRCSFTHFELFSIIRRLHARVSAKTREKK 2 QQ GHE + + +F + S IRR +++ K++ KK Sbjct: 93 QQYAGHERSEESIEGAFEKLLMSSFIRRKKTKINLKSKLKK 133 >At5g23040.1 68418.m02693 expressed protein similar to unknown protein (emb|CAB62636.1) Length = 258 Score = 27.5 bits (58), Expect = 5.5 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 124 QQSVGHELASANSRCSFTHFELFSIIRRLHARVSAKTREKK 2 QQ GHE + + +F + S IRR +++ K++ KK Sbjct: 93 QQYAGHERSEESIEGAFEKLLMSSFIRRKKTKINLKSKLKK 133 >At1g48250.1 68414.m05388 hypothetical protein Length = 354 Score = 27.1 bits (57), Expect = 7.3 Identities = 22/77 (28%), Positives = 35/77 (45%), Gaps = 2/77 (2%) Frame = +1 Query: 148 CFTSRKTNRQQDRDP*EARQNVQGYSRCSVRIRFQDKLRRWQVNWIR--FDLRHTRSGQE 321 C R++ R+Q+R EA V+ +R + ++ L + H SG E Sbjct: 149 CSPLRRSKRRQNRLEEEADVAVEESTRREIGQEEEEALGETSCGGEEEAHEEAHIESGVE 208 Query: 322 VRAQAQVSPPRPVREEE 372 VRA + S R +R+EE Sbjct: 209 VRAPLRRSKRRRIRDEE 225 >At2g07715.1 68415.m00965 ribosomal protein L2, putative similar to ribosomal protein L2 [Gossypium arboreum] GI:17933133; contains Pfam profile PF00181: Ribosomal Proteins L2, RNA binding domain Length = 307 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 1/25 (4%) Frame = -3 Query: 291 KANPVD-LPPPKFVLKPNTNTTSGV 220 K N ++ PP+ +L+P TNT SG+ Sbjct: 82 KMNTIEKFAPPRKILEPTTNTISGL 106 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,168,637 Number of Sequences: 28952 Number of extensions: 231153 Number of successful extensions: 678 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 649 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 673 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 908059136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -