BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10k16 (625 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_0391 - 20287755-20288084,20288174-20288414,20288519-202888... 29 4.0 >06_03_0391 - 20287755-20288084,20288174-20288414,20288519-20288844, 20288954-20289097,20289260-20289380,20289645-20289733, 20289821-20289891,20290165-20290309,20290390-20290479, 20290991-20291239 Length = 601 Score = 28.7 bits (61), Expect = 4.0 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 4/67 (5%) Frame = +3 Query: 402 SVVWKNIEMASGPNSPVQTEQDIEDIFGDSLKTWDHFTDDAKK----NTFHDAISETQRE 569 SVV K + M++ P+ PVQ E D + + W+ A+K H E E Sbjct: 109 SVVTKLLLMSNFPSLPVQNESDSDSV---KFSLWEEPYKQARKWKPCAAKHSLPDEVPEE 165 Query: 570 NNEDFHL 590 NN F L Sbjct: 166 NNNGFIL 172 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,038,165 Number of Sequences: 37544 Number of extensions: 243503 Number of successful extensions: 577 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 569 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 577 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1513903616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -