BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10k07 (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g53020.1 68416.m05844 60S ribosomal protein L24 (RPL24B) 60S ... 78 4e-15 At2g36620.1 68415.m04490 60S ribosomal protein L24 (RPL24A) 77 5e-15 At2g44860.1 68415.m05585 60S ribosomal protein L24, putative 60 9e-10 At1g30370.1 68414.m03713 lipase class 3 family protein similar t... 27 7.7 >At3g53020.1 68416.m05844 60S ribosomal protein L24 (RPL24B) 60S ribosomal protein L24, Arabidopsis thaliana, EMBL:AC006282 Length = 163 Score = 77.8 bits (183), Expect = 4e-15 Identities = 40/101 (39%), Positives = 53/101 (52%), Gaps = 1/101 (0%) Frame = +1 Query: 46 MKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFK 225 +K LC +SG KIYPG G ++ D + F FLNSKC+ + P K+ WT +YR++ K Sbjct: 3 LKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLAWTAMYRKQHK 62 Query: 226 K-GQEEEXXXXXXXXXXXXXXXIVGASLSDIMAKRNMKPEV 345 K +E IVGA+L I KR KPEV Sbjct: 63 KDAAQEAVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEV 103 >At2g36620.1 68415.m04490 60S ribosomal protein L24 (RPL24A) Length = 164 Score = 77.4 bits (182), Expect = 5e-15 Identities = 40/101 (39%), Positives = 53/101 (52%), Gaps = 1/101 (0%) Frame = +1 Query: 46 MKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFK 225 +K LC +SG KIYPG G ++ D + F FLNSKC+ + P K+ WT +YR++ K Sbjct: 3 LKTELCRFSGQKIYPGRGIRFIRSDSQVFLFLNSKCKRYFHNKLKPSKLCWTAMYRKQHK 62 Query: 226 K-GQEEEXXXXXXXXXXXXXXXIVGASLSDIMAKRNMKPEV 345 K +E IVGA+L I KR KPEV Sbjct: 63 KDAAQEAVKRRRRATKKPYSRSIVGATLEVIQKKRAEKPEV 103 >At2g44860.1 68415.m05585 60S ribosomal protein L24, putative Length = 159 Score = 60.1 bits (139), Expect = 9e-10 Identities = 27/66 (40%), Positives = 35/66 (53%) Frame = +1 Query: 46 MKIGLCAYSGYKIYPGHGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRRKFK 225 M++ C + IYPGHG V+ D K F F SKC M+RNPRKV WT +R Sbjct: 1 MRLEKCWFCSSTIYPGHGIQFVRNDAKIFRFCRSKCHKNFKMKRNPRKVKWTKAFRAAHG 60 Query: 226 KGQEEE 243 K ++ Sbjct: 61 KDMTKD 66 >At1g30370.1 68414.m03713 lipase class 3 family protein similar to DEFECTIVE IN ANTHER DEHISCENCE1 [Arabidopsis thaliana] GI:16215706; contains Pfam profile: PF01764: Lipase Length = 529 Score = 27.1 bits (57), Expect = 7.7 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 1/51 (1%) Frame = +1 Query: 94 HGKTMVKVDGKTFTFLNSKCEAAHLMRRNPRKVTWTVLYRR-KFKKGQEEE 243 HGKT+VKV + NSK E + + + T + R F K + EE Sbjct: 269 HGKTVVKVQSGFLSIYNSKSELTRYNKESASEQTMDEVKRLVNFFKDRGEE 319 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,253,300 Number of Sequences: 28952 Number of extensions: 177830 Number of successful extensions: 371 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 364 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 369 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -