BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10k05 (539 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. 154 2e-39 DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. 27 0.40 Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like pr... 26 0.70 Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. 26 0.70 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 25 1.2 DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 24 3.7 AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking p... 23 5.0 AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 pro... 23 5.0 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 23 6.5 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 6.5 AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 23 8.7 >L36067-1|AAA29362.1| 229|Anopheles gambiae polyubiquitin protein. Length = 229 Score = 154 bits (373), Expect = 2e-39 Identities = 75/76 (98%), Positives = 75/76 (98%) Frame = +1 Query: 58 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 237 MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN Sbjct: 1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 60 Query: 238 IQKESTLHLVLRLRGG 285 IQKESTLHLVLRLRGG Sbjct: 61 IQKESTLHLVLRLRGG 76 Score = 154 bits (373), Expect = 2e-39 Identities = 75/76 (98%), Positives = 75/76 (98%) Frame = +1 Query: 58 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 237 MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN Sbjct: 77 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136 Query: 238 IQKESTLHLVLRLRGG 285 IQKESTLHLVLRLRGG Sbjct: 137 IQKESTLHLVLRLRGG 152 Score = 154 bits (373), Expect = 2e-39 Identities = 75/76 (98%), Positives = 75/76 (98%) Frame = +1 Query: 58 MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 237 MQIFVKTLTGKTITLEVE SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN Sbjct: 153 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 212 Query: 238 IQKESTLHLVLRLRGG 285 IQKESTLHLVLRLRGG Sbjct: 213 IQKESTLHLVLRLRGG 228 >DQ004400-1|AAY21239.1| 144|Anopheles gambiae lysozyme c-5 protein. Length = 144 Score = 27.1 bits (57), Expect = 0.40 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 6/50 (12%) Frame = -2 Query: 427 WVSDC*CVRTLSCDSW*HED--ED---GHSIYGKSFSHSYTSWR-ECEGK 296 W++ C L C S ++D +D SIY +SF +S+ WR C+GK Sbjct: 84 WIAGNEC--HLKCSSLVNDDISDDMRCARSIYRRSFFNSWEGWRNNCQGK 131 >Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like protease ANCHYM1 protein. Length = 259 Score = 26.2 bits (55), Expect = 0.70 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 265 PGEVWILSGCYSLKECGHLLIVSR 194 PG++ +L G SLKE G LL V + Sbjct: 81 PGDLMVLVGTNSLKEGGELLKVDK 104 >Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. Length = 259 Score = 26.2 bits (55), Expect = 0.70 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -2 Query: 265 PGEVWILSGCYSLKECGHLLIVSR 194 PG++ +L G SLKE G LL V + Sbjct: 81 PGDLMVLVGTNSLKEGGELLKVDK 104 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 25.4 bits (53), Expect = 1.2 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 3/56 (5%) Frame = -1 Query: 176 WSGGIPSLSWILALTFSIVSEASTSNVMVFPVRVLTNICIVLLL*KT---CLERKR 18 WSG I ++W ++T + V +T VFP+ + LL T C ER R Sbjct: 293 WSGTIVHIAWQFSVTVARVLAIATV-ASVFPLYTAAACAVHALLMATWVFCYERPR 347 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 23.8 bits (49), Expect = 3.7 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = +1 Query: 4 FDLTFLFLSKHVFHRSNTMQIFVKTL 81 FD F FHR TM+ F+KTL Sbjct: 76 FDTYFQVGPLQAFHRVITMENFMKTL 101 >AY578812-1|AAT07317.1| 932|Anopheles gambiae wishful thinking protein. Length = 932 Score = 23.4 bits (48), Expect = 5.0 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 120 VGSFHLQCNGLPRKGFDEYLHCVAP 46 +G F L C LP+KG E L + P Sbjct: 205 IGGF-LSCRQLPKKGTGELLEHMEP 228 >AF281078-1|AAF82131.1| 2051|Anopheles gambiae vitellogenin 1 protein. Length = 2051 Score = 23.4 bits (48), Expect = 5.0 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +3 Query: 87 EDHYIGGGSFRHYRK 131 +DHY+ G F H RK Sbjct: 912 DDHYVPSGFFFHLRK 926 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 23.0 bits (47), Expect = 6.5 Identities = 11/41 (26%), Positives = 21/41 (51%) Frame = +1 Query: 154 KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL 276 K P Q R IF G+ +++ + +Q++ HL++ L Sbjct: 588 KREFPDLQNRTIFTGRFVKELYDVRSGCVQEQDGTHLLMNL 628 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.0 bits (47), Expect = 6.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +3 Query: 18 SFSFQARFS*EQHNANIRQNPYGEDHYIGGG 110 +FS+Q HN + R P G + GGG Sbjct: 1395 NFSYQHPHPHHHHNGSGRSKPPGPEGVGGGG 1425 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 22.6 bits (46), Expect = 8.7 Identities = 9/18 (50%), Positives = 10/18 (55%) Frame = +1 Query: 334 KMICRKCYARLHPRATNC 387 K +CRKC HPR C Sbjct: 633 KAVCRKC----HPRCKKC 646 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 566,959 Number of Sequences: 2352 Number of extensions: 12001 Number of successful extensions: 19 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 50320221 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -