BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j24 (652 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0519 - 19945456-19945653,19947110-19947112 52 5e-07 11_06_0495 - 24319531-24320831,24320923-24321109,24322919-243230... 46 3e-05 11_04_0144 + 14044973-14044984,14045050-14045183,14045329-140458... 27 9.8 >12_02_0519 - 19945456-19945653,19947110-19947112 Length = 66 Score = 51.6 bits (118), Expect = 5e-07 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = +3 Query: 144 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFVVCGS 254 KNIT RG+VP+TT +K + YPV P +L FIFVV GS Sbjct: 17 KNITKRGSVPETTVKKGNDYPVGPMVLGFFIFVVIGS 53 >11_06_0495 - 24319531-24320831,24320923-24321109,24322919-24323062, 24324467-24324469 Length = 544 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/33 (60%), Positives = 25/33 (75%) Frame = +3 Query: 144 KNITMRGNVPKTTKEKEDQYPVAPWLLALFIFV 242 KNIT RG+VP+TT +K + YPV P +L FIFV Sbjct: 17 KNITKRGSVPETTVKKGNDYPVGPLVLGFFIFV 49 >11_04_0144 + 14044973-14044984,14045050-14045183,14045329-14045824, 14046097-14046117,14047504-14047767,14048635-14048715 Length = 335 Score = 27.5 bits (58), Expect = 9.8 Identities = 9/39 (23%), Positives = 18/39 (46%) Frame = -1 Query: 421 PPPKTLSLMSMKRCWCKLCLNFRWIVLLFYCVFDSSSPV 305 P P ++ +K+CW + F W+ F+ + P+ Sbjct: 240 PSPDGINGYFLKKCWPIISQEFYWLAAHFHACYTDLQPI 278 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,433,662 Number of Sequences: 37544 Number of extensions: 339802 Number of successful extensions: 722 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 699 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 722 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -