BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j24 (652 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L10441-1|AAA29361.1| 154|Anopheles gambiae transposase protein. 24 4.8 L10438-1|AAA29359.1| 154|Anopheles gambiae transposase protein. 24 4.8 AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14... 23 8.4 >L10441-1|AAA29361.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 23.8 bits (49), Expect = 4.8 Identities = 13/50 (26%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 626 DYFIHYILMEFVA*VVFKNYIEKETKIHRKFYNRYL-NVPNNLMYRRPVL 480 D + Y+ ++ ++F +YIEK I+ ++Y + L + + + +RP L Sbjct: 70 DKVMAYVFLDSQG-IIFIDYIEKGKTINSEYYIKLLERLKDEIATKRPHL 118 >L10438-1|AAA29359.1| 154|Anopheles gambiae transposase protein. Length = 154 Score = 23.8 bits (49), Expect = 4.8 Identities = 13/50 (26%), Positives = 28/50 (56%), Gaps = 1/50 (2%) Frame = -3 Query: 626 DYFIHYILMEFVA*VVFKNYIEKETKIHRKFYNRYL-NVPNNLMYRRPVL 480 D + Y+ ++ ++F +YIEK I+ ++Y + L + + + +RP L Sbjct: 70 DKVMAYVFLDSQG-IIFIDYIEKGKTINSEYYIKLLERLKDEIATKRPHL 118 >AF007166-1|AAB62929.1| 360|Anopheles gambiae serine protease 14D protein. Length = 360 Score = 23.0 bits (47), Expect = 8.4 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = +2 Query: 212 TLAPCSLHLRSVWLCCVPDNPINKTSLNHEDN 307 T + C L+ R +CC KTSL N Sbjct: 68 TESRCGLYERKTLVCCAGVRSKGKTSLPESPN 99 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 666,729 Number of Sequences: 2352 Number of extensions: 15194 Number of successful extensions: 15 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -