Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= bmov10j16
         (633 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p...    24   4.6  
AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote...    23   6.1  

>AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein
           protein.
          Length = 1077

 Score = 23.8 bits (49), Expect = 4.6
 Identities = 9/31 (29%), Positives = 17/31 (54%)
 Frame = +1

Query: 97  IPNNRGGIHLQAAKTISKFTDGEKFRIEEHC 189
           +P NRGG++L     ++K     ++  E+ C
Sbjct: 840 LPRNRGGLNLHLPAIMAKALLTNRYVTEQDC 870


>AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein
            protein.
          Length = 1645

 Score = 23.4 bits (48), Expect = 6.1
 Identities = 9/13 (69%), Positives = 11/13 (84%)
 Frame = +2

Query: 218  SCKRRHGSHSTFA 256
            S KRR G+H+TFA
Sbjct: 1034 SLKRRKGAHTTFA 1046


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 621,324
Number of Sequences: 2352
Number of extensions: 12473
Number of successful extensions: 24
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 24
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 61886940
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)