BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j15 (448 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g43010.1 68418.m05245 26S proteasome AAA-ATPase subunit (RPT4... 167 3e-42 At1g45000.1 68414.m05158 26S proteasome regulatory complex subun... 167 3e-42 At5g19990.1 68418.m02379 26S proteasome AAA-ATPase subunit (RPT6a) 57 5e-09 At5g20000.1 68418.m02380 26S proteasome AAA-ATPase subunit, puta... 56 1e-08 At5g58290.1 68418.m07297 26S proteasome AAA-ATPase subunit (RPT3... 48 2e-06 At4g29040.1 68417.m04153 26S proteasome AAA-ATPase subunit (RPT2... 48 2e-06 At2g20140.1 68415.m02353 26S protease regulatory complex subunit... 48 2e-06 At1g53780.1 68414.m06120 26S proteasome AAA-ATPase subunit, puta... 34 0.038 At1g53750.1 68414.m06115 26S proteasome AAA-ATPase subunit (RPT1... 33 0.088 At2g34450.1 68415.m04227 high mobility group (HMG1/2) family pro... 32 0.15 At5g60070.1 68418.m07532 ankyrin repeat family protein contains ... 30 0.62 At3g49840.1 68416.m05449 proline-rich family protein contains pr... 30 0.82 At2g33793.1 68415.m04145 expressed protein 30 0.82 At1g51940.1 68414.m05855 protein kinase family protein / peptido... 30 0.82 At3g19670.1 68416.m02492 FF domain-containing protein / WW domai... 29 1.1 At1g78700.1 68414.m09173 brassinosteroid signalling positive reg... 29 1.4 At3g61130.1 68416.m06841 glycosyl transferase family 8 protein c... 29 1.9 At5g53450.2 68418.m06643 protein kinase family protein contains ... 28 2.5 At5g53450.1 68418.m06642 protein kinase family protein contains ... 28 2.5 At5g48600.1 68418.m06011 structural maintenance of chromosomes (... 28 2.5 At3g47460.1 68416.m05161 SMC2-like condensin, putative similar t... 28 2.5 At5g48660.1 68418.m06022 expressed protein ; expression supporte... 28 3.3 At5g11260.1 68418.m01315 bZIP protein HY5 (HY5) identical to HY5... 28 3.3 At1g62630.1 68414.m07066 disease resistance protein (CC-NBS-LRR ... 28 3.3 At3g54670.1 68416.m06049 structural maintenance of chromosomes (... 27 4.4 At3g48670.2 68416.m05314 XH/XS domain-containing protein / XS zi... 27 4.4 At3g48670.1 68416.m05313 XH/XS domain-containing protein / XS zi... 27 4.4 At1g64330.1 68414.m07290 myosin heavy chain-related similar to m... 27 4.4 At4g36150.1 68417.m05145 disease resistance protein (TIR-NBS-LRR... 27 5.8 At2g45560.1 68415.m05665 cytochrome P450 family protein 27 5.8 At2g45550.1 68415.m05664 cytochrome P450 family protein 27 5.8 At2g28650.1 68415.m03483 exocyst subunit EXO70 family protein co... 27 5.8 At2g16890.2 68415.m01944 UDP-glucoronosyl/UDP-glucosyl transfera... 27 5.8 At2g16890.1 68415.m01943 UDP-glucoronosyl/UDP-glucosyl transfera... 27 5.8 At1g66120.1 68414.m07504 acyl-activating enzyme 11 (AAE11) simil... 27 5.8 At1g62740.1 68414.m07081 stress-inducible protein, putative simi... 27 5.8 At1g56660.1 68414.m06516 expressed protein 27 5.8 At5g46070.1 68418.m05665 guanylate-binding family protein contai... 27 7.6 At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almos... 27 7.6 At2g29040.1 68415.m03530 exostosin family protein contains Pfam ... 27 7.6 At1g67230.1 68414.m07652 expressed protein 27 7.6 At1g13120.1 68414.m01521 expressed protein contains Prosite PS00... 27 7.6 >At5g43010.1 68418.m05245 26S proteasome AAA-ATPase subunit (RPT4a) gb|AAF22524.1 Length = 399 Score = 167 bits (406), Expect = 3e-42 Identities = 76/118 (64%), Positives = 98/118 (83%) Frame = +2 Query: 92 REKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQL 271 R A +YRKKL++HKE+ESR++ R+ L+ K+++K+E+DLK+LQSVGQI+GEVL+ L Sbjct: 11 RTAAVSEYRKKLLQHKELESRVRTARENLRGAKKEFNKTEDDLKSLQSVGQIIGEVLRPL 70 Query: 272 TEEKFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNM 445 E+ IVKA++GPRYVVGCR ++DK KL GTRV LDMTTLTIMR LPREVDP+VYNM Sbjct: 71 DNERLIVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNM 128 >At1g45000.1 68414.m05158 26S proteasome regulatory complex subunit p42D, putative similar to 26S proteasome regulatory complex subunit p42D [Drosophila melanogaster] gi|6434958|gb|AAF08391 Length = 399 Score = 167 bits (406), Expect = 3e-42 Identities = 77/118 (65%), Positives = 97/118 (82%) Frame = +2 Query: 92 REKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQL 271 R A DYRKKL+ HKE+ESR++ R+ L+ K+++K+E+DLK+LQSVGQI+GEVL+ L Sbjct: 11 RTAAVTDYRKKLLHHKELESRVRTARENLRAAKKEFNKTEDDLKSLQSVGQIIGEVLRPL 70 Query: 272 TEEKFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLVYNM 445 E+ IVKA++GPRYVVGCR ++DK KL GTRV LDMTTLTIMR LPREVDP+VYNM Sbjct: 71 DNERLIVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNM 128 >At5g19990.1 68418.m02379 26S proteasome AAA-ATPase subunit (RPT6a) Length = 419 Score = 57.2 bits (132), Expect = 5e-09 Identities = 36/124 (29%), Positives = 59/124 (47%) Frame = +2 Query: 65 ASTSDMEPLREKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQ 244 A+ E L++ Q + + ++ + L Q +L + +L+ LQ G Sbjct: 24 AAAKQGEGLKQYYLQHIHELQRQLRQKTNNLNRLEAQRNELNSRVRMLREELQLLQEPGS 83 Query: 245 IVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREV 424 VGEV+K + + K +VK +YVV + +D K+ TRVAL + + LP +V Sbjct: 84 YVGEVVKVMGKNKVLVKVHPEGKYVVDIDKSIDITKITPSTRVALRNDSYVLHLVLPSKV 143 Query: 425 DPLV 436 DPLV Sbjct: 144 DPLV 147 >At5g20000.1 68418.m02380 26S proteasome AAA-ATPase subunit, putative almost identical to 26S proteasome AAA-ATPase subunit RPT6a GI:6652888 from [Arabidopsis thaliana]; almost identical to a member of conserved Sug1 CAD family AtSUG1 GI:13537115 from [Arabidopsis thaliana] Length = 419 Score = 56.0 bits (129), Expect = 1e-08 Identities = 37/110 (33%), Positives = 56/110 (50%), Gaps = 1/110 (0%) Frame = +2 Query: 110 DYRKKLMEHKEVE-SRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEEKF 286 D ++L K +RL+ R++L + +L+ LQ G VGEV+K + + K Sbjct: 41 DELQRLQREKSYNLNRLEAQRNELNSRVRML---REELQLLQEPGSYVGEVVKVMGKNKV 97 Query: 287 IVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLV 436 +VK +YVV + +D KL TRVAL + + LP +VDPLV Sbjct: 98 LVKVHPEGKYVVDIDKSIDITKLTPSTRVALRNDSYVLHLVLPSKVDPLV 147 >At5g58290.1 68418.m07297 26S proteasome AAA-ATPase subunit (RPT3) identical to 26S proteasome AAA-ATPase subunit RPT3 GI:6652882 from [Arabidopsis thaliana] Length = 408 Score = 48.4 bits (110), Expect = 2e-06 Identities = 32/130 (24%), Positives = 66/130 (50%) Frame = +2 Query: 59 MPASTSDMEPLREKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSV 238 M ST+D E L + R+ +E +++ +D+ K+L ++ +++ ++K +QSV Sbjct: 20 MDLSTADEEDLYGRLKSLERQ--LEFTDIQEEYV--KDEQKNLKRELLRAQEEVKRIQSV 75 Query: 239 GQIVGEVLKQLTEEKFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPR 418 ++G+ ++ + + IV +T G Y V +++ LK VAL + ++ LP Sbjct: 76 PLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPP 135 Query: 419 EVDPLVYNMS 448 E D + +S Sbjct: 136 EADSSISLLS 145 >At4g29040.1 68417.m04153 26S proteasome AAA-ATPase subunit (RPT2a) almost identical to 26S proteasome AAA-ATPase subunit RPT2a (GI:6652880) {Arabidopsis thaliana}; Drosophila melanogaster 26S proteasome subunit 4 ATPase, PID:g1066065 Length = 443 Score = 48.4 bits (110), Expect = 2e-06 Identities = 25/106 (23%), Positives = 56/106 (52%) Frame = +2 Query: 119 KKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEEKFIVKA 298 +++ ++ +E +++LK ++ ++ + + L+ VG + + + E IV + Sbjct: 69 ERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSS 128 Query: 299 TNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLV 436 + GP Y VG +DK++L+ G + + L+++ L EVDP+V Sbjct: 129 SVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMV 174 >At2g20140.1 68415.m02353 26S protease regulatory complex subunit 4, putative similar to Swiss-Prot:P48601 26S protease regulatory subunit 4 (P26S4) [Drosophila melanogaster] Length = 443 Score = 48.4 bits (110), Expect = 2e-06 Identities = 25/106 (23%), Positives = 56/106 (52%) Frame = +2 Query: 119 KKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEEKFIVKA 298 +++ ++ +E +++LK ++ ++ + + L+ VG + + + E IV + Sbjct: 69 ERIKDYLLMEEEFVANQERLKPQEEKAEEDRSKVDDLRGTPMSVGNLEELIDENHAIVSS 128 Query: 299 TNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDPLV 436 + GP Y VG +DK++L+ G + + L+++ L EVDP+V Sbjct: 129 SVGPEYYVGILSFVDKDQLEPGCSILMHNKVLSVVGILQDEVDPMV 174 >At1g53780.1 68414.m06120 26S proteasome AAA-ATPase subunit, putative similar to 26S proteasome AAA-ATPase subunit RPT1 SP:Q41365 from [Spinacia oleracea] Length = 464 Score = 34.3 bits (75), Expect = 0.038 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 1/66 (1%) Frame = +2 Query: 254 EVLKQLTEE-KFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDP 430 +++ TE+ K++V +YVVG + ++ G RV +D I LP ++DP Sbjct: 130 QIISPNTEDAKYVVDIKKIGKYVVGLGDKASPTDIEAGMRVGVDQKKYQIQIPLPPKIDP 189 Query: 431 LVYNMS 448 V M+ Sbjct: 190 SVTMMT 195 >At1g53750.1 68414.m06115 26S proteasome AAA-ATPase subunit (RPT1a) similar to 26S proteasome ATPase subunit GI:1395190 from [Spinacia oleracea] Length = 426 Score = 33.1 bits (72), Expect = 0.088 Identities = 17/66 (25%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Frame = +2 Query: 254 EVLKQLTEE-KFIVKATNGPRYVVGCRRQLDKNKLKGGTRVALDMTTLTIMRHLPREVDP 430 +++ TE+ K+++ ++VVG ++ ++ G RV +D I LP ++DP Sbjct: 93 KIISPNTEDAKYVINVKQIAKFVVGLGDKVSPTDIEEGMRVGVDRNKYQIQIPLPPKIDP 152 Query: 431 LVYNMS 448 V M+ Sbjct: 153 SVTMMT 158 >At2g34450.1 68415.m04227 high mobility group (HMG1/2) family protein similar to HMG protein [Arabidopsis thaliana] GI:2832361; contains Pfam profile PF00505: HMG (high mobility group) box Length = 151 Score = 32.3 bits (70), Expect = 0.15 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +2 Query: 176 LKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEEK 283 L D KQY + D+K+++ +G+ GE K +T E+ Sbjct: 74 LDDFRKQYQEENPDVKSMREIGKTCGEKWKTMTYEE 109 >At5g60070.1 68418.m07532 ankyrin repeat family protein contains ankyrin repeat domains, Pfam:PF00023 Length = 548 Score = 30.3 bits (65), Expect = 0.62 Identities = 27/89 (30%), Positives = 39/89 (43%), Gaps = 5/89 (5%) Frame = +2 Query: 137 KEVESRLKEGRDQLKD-LTKQYDKSENDLKALQSVG--QIVGEVLKQLTEEKFIVKATNG 307 KE+ S E D+L+D L KQ E L G +V E++K E KA NG Sbjct: 49 KEILSNHMESEDELRDLLRKQNQCGETALYVAAEYGDADVVAELIKYYDLEDAETKARNG 108 Query: 308 --PRYVVGCRRQLDKNKLKGGTRVALDMT 388 P ++ + +LD ++ L MT Sbjct: 109 FDPFHIAAKQGELDVLRVLMEEHPELSMT 137 >At3g49840.1 68416.m05449 proline-rich family protein contains proline rich extensin domains, INTERPRO:IPR002965 Length = 606 Score = 29.9 bits (64), Expect = 0.82 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 3/91 (3%) Frame = +2 Query: 47 KLFTMPASTSDMEPLREKAFQDYRKKLMEHKEVESRLKEGRDQ-LKDLTKQYDK--SEND 217 KL T+P S SD+ P + R+KL + +E++ KE + LK+L ++ S ++ Sbjct: 383 KLRTVPLSESDIFPSSFHKTPEGRRKLTK-EELQKFTKESTENALKELVSSPEEGSSGSE 441 Query: 218 LKALQSVGQIVGEVLKQLTEEKFIVKATNGP 310 +A + + VGE K+ +++ K N P Sbjct: 442 KQAARGTSEPVGECTKK-KKQRVRYKERNKP 471 >At2g33793.1 68415.m04145 expressed protein Length = 212 Score = 29.9 bits (64), Expect = 0.82 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 1/65 (1%) Frame = +2 Query: 74 SDMEPLREKAFQDYRKKLMEH-KEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIV 250 S ++ REKA +D RKK E V + +K D+LK +K + +N KAL + Sbjct: 45 SALQQFREKAHEDGRKKKEESISSVSTEVKSKIDELK--SKLEKERQNFSKALSKSSKEC 102 Query: 251 GEVLK 265 +LK Sbjct: 103 ENILK 107 >At1g51940.1 68414.m05855 protein kinase family protein / peptidoglycan-binding LysM domain-containing protein contains protein kinases ATP-binding region signature, PROSITE:PS00107 Length = 651 Score = 29.9 bits (64), Expect = 0.82 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 2/52 (3%) Frame = -2 Query: 216 SFSLLSYCLVKSFSWSRPSLSRDSTSLCS--MSFFL*SWKAFSLNGSMSDVL 67 +F + L+ SFS S+P D+T LCS ++F ++FS+ SM DVL Sbjct: 4 TFYIFFLSLLPSFSSSKPMNCSDTTRLCSSFLAFKPNQNQSFSVIQSMFDVL 55 >At3g19670.1 68416.m02492 FF domain-containing protein / WW domain-containing protein weak similarity to huntingtin-interacting protein HYPA/FBP11 [Homo sapiens] GI:3341980; contains Pfam profiles PF01846: FF domain, PF00397: WW domain Length = 960 Score = 29.5 bits (63), Expect = 1.1 Identities = 15/49 (30%), Positives = 28/49 (57%) Frame = +2 Query: 68 STSDMEPLREKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSEN 214 ST E R++ F+DY L KE +R+K+ + +D+ +++DK + Sbjct: 797 STIGDESFRKRCFEDYVSLL---KEQSNRIKQNKKVPEDVREEHDKGRD 842 >At1g78700.1 68414.m09173 brassinosteroid signalling positive regulator-related contains similarity to BZR1 protein [Arabidopsis thaliana] gi|20270971|gb|AAM18490 Length = 325 Score = 29.1 bits (62), Expect = 1.4 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 254 EVLKQLTEEKFIVKATNGPRYVVGCRRQLDKNKLKGGTRVA 376 EVLK L E + +G Y GC R +++ ++ GG+ A Sbjct: 50 EVLKALCNEAGWIVEPDGTTYRKGCSRPVERMEIGGGSATA 90 >At3g61130.1 68416.m06841 glycosyl transferase family 8 protein contains Pfam profile: PF01501 glycosyl transferase family 8 Length = 673 Score = 28.7 bits (61), Expect = 1.9 Identities = 13/51 (25%), Positives = 30/51 (58%) Frame = +2 Query: 137 KEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEEKFI 289 +E+++RLK+ + L + T D + + L+++GQ++ + QL + K + Sbjct: 245 QELQARLKDSQRVLGEATSDADLPRSAHEKLRAMGQVLAKAKMQLYDCKLV 295 >At5g53450.2 68418.m06643 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 590 Score = 28.3 bits (60), Expect = 2.5 Identities = 21/68 (30%), Positives = 33/68 (48%) Frame = +2 Query: 83 EPLREKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVL 262 E L EK + KK++ KE S L K ++ + + + N + S G ++GEV Sbjct: 489 EGLAEKLETEKWKKVVPFKEFPSSLPVA----KLVSGEIEVTMNMNDHIDSPGSVIGEVR 544 Query: 263 KQLTEEKF 286 KQ+ E F Sbjct: 545 KQIPPEMF 552 >At5g53450.1 68418.m06642 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 670 Score = 28.3 bits (60), Expect = 2.5 Identities = 21/68 (30%), Positives = 33/68 (48%) Frame = +2 Query: 83 EPLREKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVL 262 E L EK + KK++ KE S L K ++ + + + N + S G ++GEV Sbjct: 569 EGLAEKLETEKWKKVVPFKEFPSSLPVA----KLVSGEIEVTMNMNDHIDSPGSVIGEVR 624 Query: 263 KQLTEEKF 286 KQ+ E F Sbjct: 625 KQIPPEMF 632 >At5g48600.1 68418.m06011 structural maintenance of chromosomes (SMC) family protein similar to SP|P50532 Chromosome assembly protein XCAP-C {Xenopus laevis}; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1241 Score = 28.3 bits (60), Expect = 2.5 Identities = 20/74 (27%), Positives = 40/74 (54%), Gaps = 5/74 (6%) Frame = +2 Query: 107 QDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQ----SVGQIVGEVLKQLT 274 +D + + K++E +L++ ++ D+TK+ + S N + LQ + +++ + K+L Sbjct: 344 EDLKHVKQKIKKLEDKLEKDSSKIGDMTKESEDSSNLIPKLQENIPKLQKVLLDEEKKLE 403 Query: 275 EEKFIVKA-TNGPR 313 E K I K T G R Sbjct: 404 EIKAIAKVETEGYR 417 >At3g47460.1 68416.m05161 SMC2-like condensin, putative similar to SMC2-like condensin (TITAN3) [Arabidopsis thaliana] GI:14279543; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1171 Score = 28.3 bits (60), Expect = 2.5 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%) Frame = +2 Query: 119 KKLMEH-KEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEEKFIVK 295 K + +H K E RLK+ +K L + S DLK ++V + + + +T+E+ +K Sbjct: 773 KSIKDHDKNREGRLKDLEKNIKTLKARIQASSKDLKGHENVRERLVMEQEAVTQEQSYLK 832 Query: 296 A 298 + Sbjct: 833 S 833 >At5g48660.1 68418.m06022 expressed protein ; expression supported by MPSS Length = 219 Score = 27.9 bits (59), Expect = 3.3 Identities = 12/53 (22%), Positives = 30/53 (56%) Frame = +2 Query: 74 SDMEPLREKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQ 232 ++++ EKA ++ ++ ++ + RLK+ + K+ K+ + +E + ALQ Sbjct: 137 TELKEKEEKASKEIKQLQVKLSSITERLKKAETESKEKEKKLETAETHVTALQ 189 >At5g11260.1 68418.m01315 bZIP protein HY5 (HY5) identical to HY5 protein GI:2251085 from [Arabidopsis thaliana] Length = 168 Score = 27.9 bits (59), Expect = 3.3 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +2 Query: 155 LKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEEK 283 L E +++KDL + + E L LQ+ Q++ +LK T K Sbjct: 113 LSELENRVKDLENKNSELEERLSTLQNENQMLRHILKNTTGNK 155 >At1g62630.1 68414.m07066 disease resistance protein (CC-NBS-LRR class), putative domain signature CC-NBS-LRR exists, suggestive of a disease resistance protein. Length = 893 Score = 27.9 bits (59), Expect = 3.3 Identities = 25/88 (28%), Positives = 40/88 (45%), Gaps = 3/88 (3%) Frame = +2 Query: 92 REKAFQDYRKKLMEHKEVE-SRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQ 268 R +D L+ ++VE RL R K+LT Y ++ L+ V ++ GEV Sbjct: 75 RVATVEDIIITLLRDRDVEIQRLCLCRFCSKNLTTSYRYGKSVFLRLREVEKLKGEVFGV 134 Query: 269 LTEEKFIVKATNGPRY--VVGCRRQLDK 346 +TE+ P +VG ++ LDK Sbjct: 135 ITEQASTSAFEERPLQPTIVGQKKMLDK 162 >At3g54670.1 68416.m06049 structural maintenance of chromosomes (SMC) family protein similar to SMC1 protein [Bos taurus] GI:4235253, 14S cohesin SMC1 subunit (SMC protein) [Xenopus laevis] GI:3328231; contains Pfam profiles PF02483: SMC family C-terminal domain, PF02463: RecF/RecN/SMC N terminal domain Length = 1257 Score = 27.5 bits (58), Expect = 4.4 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = +2 Query: 140 EVESRLKEGRDQLKDLTKQYDKSENDLKALQSV 238 ++++R+ E DQL DLT + ++E D + Q+V Sbjct: 478 KLKTRIAELEDQLSDLTAERYENERDSRLTQAV 510 >At3g48670.2 68416.m05314 XH/XS domain-containing protein / XS zinc finger domain-containing protein contains Pfam domains PF03469: XH domain, PF03468: XS domain and PF03470: XS zinc finger domain Length = 647 Score = 27.5 bits (58), Expect = 4.4 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +2 Query: 119 KKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEEK 283 K + E E E+R +E Q +L + ++ + D+K ++ + + E L QL EEK Sbjct: 251 KTIAELTEEEARKQELLVQ--NLRQLVEEKKKDMKEIEELCSVKSEELNQLMEEK 303 >At3g48670.1 68416.m05313 XH/XS domain-containing protein / XS zinc finger domain-containing protein contains Pfam domains PF03469: XH domain, PF03468: XS domain and PF03470: XS zinc finger domain Length = 647 Score = 27.5 bits (58), Expect = 4.4 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = +2 Query: 119 KKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEEK 283 K + E E E+R +E Q +L + ++ + D+K ++ + + E L QL EEK Sbjct: 251 KTIAELTEEEARKQELLVQ--NLRQLVEEKKKDMKEIEELCSVKSEELNQLMEEK 303 >At1g64330.1 68414.m07290 myosin heavy chain-related similar to myosin heavy chain (GI:1850913) [Entamoeba histolytica]; similar to Intracellular protein transport protein USO1 (Swiss-Prot:P25386) [Saccharomyces cerevisiae] Length = 555 Score = 27.5 bits (58), Expect = 4.4 Identities = 15/55 (27%), Positives = 28/55 (50%) Frame = +2 Query: 131 EHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTEEKFIVK 295 EH+E+ +LKE + +L + +K ++ K L ++ GE L ++ VK Sbjct: 154 EHQEILKKLKESDEICGNLRVETEKLTSENKELNEKLEVAGETESDLNQKLEDVK 208 >At4g36150.1 68417.m05145 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1179 Score = 27.1 bits (57), Expect = 5.8 Identities = 14/44 (31%), Positives = 28/44 (63%), Gaps = 1/44 (2%) Frame = +2 Query: 152 RLKEGRDQLKDLTKQYDKSENDLKAL-QSVGQIVGEVLKQLTEE 280 +L + + LKD+ K+ + +++ +S+ QIVGEV+K L+ + Sbjct: 140 KLDKWKQALKDVPKKLGFTLSEMSDEGESINQIVGEVIKVLSSD 183 >At2g45560.1 68415.m05665 cytochrome P450 family protein Length = 512 Score = 27.1 bits (57), Expect = 5.8 Identities = 15/41 (36%), Positives = 20/41 (48%), Gaps = 2/41 (4%) Frame = -2 Query: 264 FKTSPTICPTLCKAFRSFSLLSYCLVKSFSWSRPS--LSRD 148 F ICP + A ++ SL+ L+ SF W P LS D Sbjct: 443 FGAGRRICPGMPLAMKTVSLMLASLLYSFDWKLPKGVLSED 483 >At2g45550.1 68415.m05664 cytochrome P450 family protein Length = 511 Score = 27.1 bits (57), Expect = 5.8 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 246 ICPTLCKAFRSFSLLSYCLVKSFSWSRPS 160 ICP L A ++ SL+ L+ SF W P+ Sbjct: 449 ICPGLPLAVKTVSLMLASLLYSFDWKLPN 477 >At2g28650.1 68415.m03483 exocyst subunit EXO70 family protein contains Pfam domain PF03081: Exo70 exocyst complex subunit Length = 573 Score = 27.1 bits (57), Expect = 5.8 Identities = 10/29 (34%), Positives = 18/29 (62%) Frame = +2 Query: 50 LFTMPASTSDMEPLREKAFQDYRKKLMEH 136 LFT+ ++S L++ + Q + + LMEH Sbjct: 3 LFTLSTTSSSSSKLKQHSHQSFSESLMEH 31 >At2g16890.2 68415.m01944 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 478 Score = 27.1 bits (57), Expect = 5.8 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 7/70 (10%) Frame = +2 Query: 47 KLFTMPASTSDMEPLREKAFQ-------DYRKKLMEHKEVESRLKEGRDQLKDLTKQYDK 205 +LFT P S SD EP+ F D+ E +E + L+ DQ+K T + Sbjct: 163 ELFTEPESKSDTEPVTVPDFPWIKVKKCDFDHGTTEPEESGAALELSMDQIKSTTTSHGF 222 Query: 206 SENDLKALQS 235 N L+S Sbjct: 223 LVNSFYELES 232 >At2g16890.1 68415.m01943 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 312 Score = 27.1 bits (57), Expect = 5.8 Identities = 21/70 (30%), Positives = 30/70 (42%), Gaps = 7/70 (10%) Frame = +2 Query: 47 KLFTMPASTSDMEPLREKAFQ-------DYRKKLMEHKEVESRLKEGRDQLKDLTKQYDK 205 +LFT P S SD EP+ F D+ E +E + L+ DQ+K T + Sbjct: 163 ELFTEPESKSDTEPVTVPDFPWIKVKKCDFDHGTTEPEESGAALELSMDQIKSTTTSHGF 222 Query: 206 SENDLKALQS 235 N L+S Sbjct: 223 LVNSFYELES 232 >At1g66120.1 68414.m07504 acyl-activating enzyme 11 (AAE11) similar to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501; identical to cDNA acyl-activating enzyme 11 (At1g66120) GI:29893230, acyl-activating enzyme 11 [Arabidopsis thaliana] GI:29893231 Length = 572 Score = 27.1 bits (57), Expect = 5.8 Identities = 18/56 (32%), Positives = 34/56 (60%), Gaps = 3/56 (5%) Frame = +2 Query: 104 FQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSV---GQIVGEVL 262 +QD KL EH+++E + ++G +++LT D + K L+SV G+ +GE++ Sbjct: 345 WQDEWNKLPEHQQIELQQRQG---VRNLTLA-DVDVKNTKTLESVPRDGKTMGEIV 396 >At1g62740.1 68414.m07081 stress-inducible protein, putative similar to sti (stress inducible protein) [Glycine max] GI:872116; contains Pfam profile PF00515 TPR Domain Length = 571 Score = 27.1 bits (57), Expect = 5.8 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Frame = +2 Query: 95 EKAFQDYRKKLMEHKEVES--RLKEGRDQLKDLTKQ--YDKSEND 217 E Q Y+K L EH+ E+ RL E K+L +Q YD + D Sbjct: 339 EPVIQTYQKALTEHRNPETLKRLNEAERAKKELEQQEYYDPNIGD 383 >At1g56660.1 68414.m06516 expressed protein Length = 522 Score = 27.1 bits (57), Expect = 5.8 Identities = 16/62 (25%), Positives = 31/62 (50%) Frame = +2 Query: 98 KAFQDYRKKLMEHKEVESRLKEGRDQLKDLTKQYDKSENDLKALQSVGQIVGEVLKQLTE 277 K +D +K + K+V+ + +++ KD + K ND+ L++ + E + L E Sbjct: 447 KMTEDEEEKKDDSKDVKIEGSKAKEEKKDKDVKKKKGGNDIGKLKTKLAKIDEKIGALME 506 Query: 278 EK 283 EK Sbjct: 507 EK 508 >At5g46070.1 68418.m05665 guanylate-binding family protein contains Pfam domains PF02263: Guanylate-binding protein, N-terminal domain and PF02841: Guanylate-binding protein, C-terminal domain Length = 1060 Score = 26.6 bits (56), Expect = 7.6 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 7/44 (15%) Frame = +2 Query: 128 MEHKEVESRLKEGRDQLKD-------LTKQYDKSENDLKALQSV 238 M+ + VE +K + QL D K+YD+S ND K L+ + Sbjct: 495 MKFRSVEDAMKHLKQQLDDSERYKLEYQKRYDESNNDKKKLEDI 538 >At5g41790.1 68418.m05088 COP1-interactive protein 1 / CIP1 almost identical to CIP1 (GI:836950) [Arabidopsis thaliana] Length = 1305 Score = 26.6 bits (56), Expect = 7.6 Identities = 19/71 (26%), Positives = 39/71 (54%), Gaps = 4/71 (5%) Frame = +2 Query: 71 TSDMEPLRE--KAFQDYRKKLMEHKE-VESRLKEGRDQLKDLTKQYDKSENDLKAL-QSV 238 T D++ E KA ++M+ E ++ +KE D+L +L ++ + E++L +L +S Sbjct: 350 TVDLKDAEEENKAISSKNLEIMDKLEQAQNTIKELMDELGELKDRHKEKESELSSLVKSA 409 Query: 239 GQIVGEVLKQL 271 Q V ++ + L Sbjct: 410 DQQVADMKQSL 420 >At2g29040.1 68415.m03530 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 720 Score = 26.6 bits (56), Expect = 7.6 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%) Frame = +2 Query: 50 LFTMPASTSDMEPLREKAFQDYRKKLMEHKE-VESRLKEGRDQLKDLTKQYDKSEN 214 ++ P+S S+ E AF + ++E E + R++EG++++ D +QY N Sbjct: 648 MYFHPSSKSEDTGRFEDAFDVAVEGVLERVEGLRKRIEEGKEEIFDFPEQYSWKYN 703 >At1g67230.1 68414.m07652 expressed protein Length = 1132 Score = 26.6 bits (56), Expect = 7.6 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 8/45 (17%) Frame = +2 Query: 95 EKAFQDYRKKLMEHKEVESRLK--------EGRDQLKDLTKQYDK 205 EKA + +KKL+E KE+ LK E + QL ++ K+ D+ Sbjct: 431 EKALETEKKKLLEDKEIILNLKALVEKVSGENQAQLSEINKEKDE 475 >At1g13120.1 68414.m01521 expressed protein contains Prosite PS00012: Phosphopantetheine attachment site; similar to GLE1 (GI:3288817) {Homo sapiens}; EST gb|N37870 comes from this gene Length = 611 Score = 26.6 bits (56), Expect = 7.6 Identities = 20/78 (25%), Positives = 43/78 (55%), Gaps = 7/78 (8%) Frame = +2 Query: 95 EKAFQDYRKKLMEHKEVESRLKEGRDQLKDLTK---QYDKSENDLKALQSVGQ-IVGE-- 256 E+A ++ R+K H+E + R ++ R + + L K + +K E + KA + V + V + Sbjct: 224 EEAQEEARRKERAHQEEKIRQEKARAEAQMLAKIRAEEEKKEVERKAAREVAEKEVADRK 283 Query: 257 -VLKQLTEEKFIVKATNG 307 ++L E+K ++++ G Sbjct: 284 AAEQKLAEQKAVIESVTG 301 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,791,648 Number of Sequences: 28952 Number of extensions: 164066 Number of successful extensions: 653 Number of sequences better than 10.0: 42 Number of HSP's better than 10.0 without gapping: 633 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 653 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 722638680 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -