BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j12 (609 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q05FW9 Cluster: Putative uncharacterized protein; n=1; ... 34 3.0 UniRef50_Q4A7T0 Cluster: Putative uncharacterized protein; n=4; ... 33 7.0 UniRef50_Q55A51 Cluster: Putative uncharacterized protein; n=2; ... 33 7.0 UniRef50_O67097 Cluster: Organic solvent tolerance protein; n=1;... 32 9.3 >UniRef50_Q05FW9 Cluster: Putative uncharacterized protein; n=1; Candidatus Carsonella ruddii PV|Rep: Putative uncharacterized protein - Carsonella ruddii (strain PV) Length = 208 Score = 33.9 bits (74), Expect = 3.0 Identities = 24/65 (36%), Positives = 34/65 (52%) Frame = +2 Query: 248 NSINYYNHFLFTDNSANSIHPLFVNYNLALLVKINNHNDLINLFPWTFKIIIDFSIFWN* 427 N+ NYY+ F +N N I+ L + YN + INN N +INL K II I + Sbjct: 46 NNYNYYSIINFINN--NKIYVLKIKYNSII---INNSNIIINLINDLKKKIIKKKIIFKI 100 Query: 428 RNLIS 442 N++S Sbjct: 101 LNILS 105 >UniRef50_Q4A7T0 Cluster: Putative uncharacterized protein; n=4; Mycoplasma hyopneumoniae|Rep: Putative uncharacterized protein - Mycoplasma hyopneumoniae (strain 7448) Length = 295 Score = 32.7 bits (71), Expect = 7.0 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%) Frame = +2 Query: 272 FLFTDNSANSIHPLFVNYNLALLV--KINNHNDLINLFPWTFKIIIDFSIF 418 FL T NS+ S ++NL LV +++ DL F W+F I +DF++F Sbjct: 135 FLLTSNSSRSTCSFLFSWNLFELVWSELDTGPDLFKWF-WSFLIWLDFAVF 184 >UniRef50_Q55A51 Cluster: Putative uncharacterized protein; n=2; Dictyostelium discoideum|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 107 Score = 32.7 bits (71), Expect = 7.0 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = +2 Query: 257 NYYNHFLFTDNSANSIHPLFV---NYNLAL-LVKINNHNDLINLFPWTF 391 NYY + F N+ NSI +++ NYNL + I+N N+ I++ P+ F Sbjct: 36 NYYENINFNQNNLNSIIKIYIGYGNYNLTCQSISISNFNN-ISISPYNF 83 >UniRef50_O67097 Cluster: Organic solvent tolerance protein; n=1; Aquifex aeolicus|Rep: Organic solvent tolerance protein - Aquifex aeolicus Length = 653 Score = 32.3 bits (70), Expect = 9.3 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 564 TLTYVIYSKNINNYLFFFRTM 502 T TY+IY K NYLF+F+T+ Sbjct: 303 TKTYLIYEKETKNYLFYFQTV 323 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 504,688,104 Number of Sequences: 1657284 Number of extensions: 9019640 Number of successful extensions: 18036 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 17295 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18027 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 43562448615 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -