BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j12 (609 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_04_0057 - 12953479-12954364,12954484-12955034,12955125-129553... 29 3.8 03_06_0364 + 33392181-33392487,33392919-33392994,33393671-333937... 29 3.8 >11_04_0057 - 12953479-12954364,12954484-12955034,12955125-12955342, 12957514-12957678,12960562-12960898 Length = 718 Score = 28.7 bits (61), Expect = 3.8 Identities = 16/61 (26%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = -3 Query: 187 RPKKFAAPGTCLDCPYSLVNKFKNALNRHKAPKNMH-DSSPDAE*CPQKCLLRAHQHTKN 11 R KF P T P ++ F+ + ++ APK+ S+P+ K +R N Sbjct: 14 RSLKFTLPNTVFFVPAGVITIFEFTMAKNMAPKSSALGSNPEVRHAQSKIAIRTSADELN 73 Query: 10 C 8 C Sbjct: 74 C 74 >03_06_0364 + 33392181-33392487,33392919-33392994,33393671-33393740, 33394291-33394320,33394724-33394867,33394954-33395058, 33395496-33395642,33396994-33397069,33397726-33397814, 33398178-33398269,33398351-33398390,33398475-33398531 Length = 410 Score = 28.7 bits (61), Expect = 3.8 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = -3 Query: 217 LKKYLISKFCRPKKFAAPGTCLDCPYSLVNKFKNALNRHK 98 LK + I +FC + A GTC C Y+ VN F+ + + Sbjct: 280 LKDHAIFRFCAIPQIMAIGTCAIC-YNNVNVFRGVVKMRR 318 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,645,414 Number of Sequences: 37544 Number of extensions: 211546 Number of successful extensions: 292 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 292 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1454766756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -