BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j12 (609 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-P... 29 3.8 >AE014134-756|AAN10358.4| 23015|Drosophila melanogaster CG33196-PB protein. Length = 23015 Score = 29.5 bits (63), Expect = 3.8 Identities = 19/63 (30%), Positives = 24/63 (38%) Frame = -3 Query: 190 CRPKKFAAPGTCLDCPYSLVNKFKNALNRHKAPKNMHDSSPDAE*CPQKCLLRAHQHTKN 11 C P + +P C P N KA + + P A C Q + RAHQH Sbjct: 18093 CLPDYYGSPPACR--PECTTNP---ECPNDKACVSRRCTDPCAGACGQNAICRAHQHRAY 18147 Query: 10 CDC 2 C C Sbjct: 18148 CSC 18150 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,410,713 Number of Sequences: 53049 Number of extensions: 402646 Number of successful extensions: 704 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 704 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2503659279 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -