BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j10 (617 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46291| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_1694| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 >SB_46291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 331 Score = 29.9 bits (64), Expect = 1.7 Identities = 13/39 (33%), Positives = 21/39 (53%) Frame = +1 Query: 484 KKFRKLLNPMGNPAFYSYPYSKNDFQLILHKMKTKQLKI 600 KKF L + NP + ND Q+ L K+++KQ+ + Sbjct: 85 KKFMLRLGKIRNPMVFFVDEQDNDIQIFLQKVRSKQVTL 123 >SB_1694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 782 Score = 27.9 bits (59), Expect = 7.0 Identities = 18/67 (26%), Positives = 26/67 (38%) Frame = +1 Query: 400 SLPKYICTECLDMLKVALNFKTNCETADKKFRKLLNPMGNPAFYSYPYSKNDFQLILHKM 579 +LP + L +L +AL + T KF+K + NP P D Q + Sbjct: 206 NLPAEAISNLLTLLSLALPISHSLPTTIYKFKKYFKNLRNPLVIHRPSFYEDMQYRFKRN 265 Query: 580 KTKQLKI 600 K K I Sbjct: 266 KRKNENI 272 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,014,037 Number of Sequences: 59808 Number of extensions: 326101 Number of successful extensions: 885 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 885 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -