BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j09 (517 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41016-4|AAP46275.1| 809|Caenorhabditis elegans Hypothetical pr... 29 2.0 U41016-2|AAM51496.1| 899|Caenorhabditis elegans Hypothetical pr... 29 2.0 AF003151-14|AAT68900.1| 399|Caenorhabditis elegans Hypothetical... 29 2.6 Z81576-3|CAB04641.1| 534|Caenorhabditis elegans Hypothetical pr... 28 4.6 Z81554-1|CAB04506.1| 838|Caenorhabditis elegans Hypothetical pr... 27 8.0 AF101310-4|AAC69214.2| 662|Caenorhabditis elegans Hypothetical ... 27 8.0 >U41016-4|AAP46275.1| 809|Caenorhabditis elegans Hypothetical protein R11G1.6d protein. Length = 809 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/53 (30%), Positives = 23/53 (43%) Frame = +1 Query: 223 GNSSIKACRTKSRSGVHKMAS*MLRDCSRSYISLCNERTHKFSAASSCHSLQI 381 G ++ C+ + RS K A RDC C+ +T F S+ LQI Sbjct: 734 GGATCNVCQQRIRSSFSKQAY-QCRDCKMVCHKTCHYKTDAFCTQSNVSKLQI 785 >U41016-2|AAM51496.1| 899|Caenorhabditis elegans Hypothetical protein R11G1.6a protein. Length = 899 Score = 29.1 bits (62), Expect = 2.0 Identities = 16/53 (30%), Positives = 23/53 (43%) Frame = +1 Query: 223 GNSSIKACRTKSRSGVHKMAS*MLRDCSRSYISLCNERTHKFSAASSCHSLQI 381 G ++ C+ + RS K A RDC C+ +T F S+ LQI Sbjct: 824 GGATCNVCQQRIRSSFSKQAY-QCRDCKMVCHKTCHYKTDAFCTQSNVSKLQI 875 >AF003151-14|AAT68900.1| 399|Caenorhabditis elegans Hypothetical protein D1007.10b protein. Length = 399 Score = 28.7 bits (61), Expect = 2.6 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +2 Query: 164 LMLTIEVIFTELLKR-GDLVQEIVPLKPAEQSPEAEYTRWLRECYETALARILACVM 331 ++ + VI+ +++R G+L++ + L E + E+ R +RE + LA + C++ Sbjct: 115 MVFCLTVIWFLVIRRMGNLIKRLSVLNQLEDAESVEWARCIREFTQEKLAVLCFCIV 171 >Z81576-3|CAB04641.1| 534|Caenorhabditis elegans Hypothetical protein R10E8.4 protein. Length = 534 Score = 27.9 bits (59), Expect = 4.6 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = +3 Query: 387 KLKGNTHWSRALDI 428 KLKGN+HW A+D+ Sbjct: 411 KLKGNSHWKHAVDL 424 >Z81554-1|CAB04506.1| 838|Caenorhabditis elegans Hypothetical protein F57G4.1 protein. Length = 838 Score = 27.1 bits (57), Expect = 8.0 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +3 Query: 84 FLTPENMRTILLIYCRCLRSKQTII 158 F TP+ ++T+L++ R + K+TII Sbjct: 802 FNTPDTLKTVLILSARSVFGKETII 826 >AF101310-4|AAC69214.2| 662|Caenorhabditis elegans Hypothetical protein C39F7.5 protein. Length = 662 Score = 27.1 bits (57), Expect = 8.0 Identities = 17/80 (21%), Positives = 39/80 (48%), Gaps = 1/80 (1%) Frame = +2 Query: 29 QQNFSKMISGQLRNKANEFLNSRKHANNL-ADILQMFEVETDNYTPLMLTIEVIFTELLK 205 +Q F K + ++ + + NL +++L+ + + L ++ ++ + LK Sbjct: 153 EQKFLKFEQDAVEIFLKSYIYNEQWPENLGSEMLEQLCTDFGCFKKLEEDVKHMYKQDLK 212 Query: 206 RGDLVQEIVPLKPAEQSPEA 265 GDL+ E+V K E++ E+ Sbjct: 213 HGDLIIEVVDGKNTEENSES 232 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,410,304 Number of Sequences: 27780 Number of extensions: 250108 Number of successful extensions: 737 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 722 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 737 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -