BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j08 (575 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 2.5 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 2.5 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 5.7 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +3 Query: 459 LDIKWDLLVKSTMTRAQETAAIIAKHLDKD 548 + +KW L V++ +T +ET+ + H+ K+ Sbjct: 1293 IHVKWPLGVRTNITYIEETSEV---HISKE 1319 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 2.5 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +3 Query: 459 LDIKWDLLVKSTMTRAQETAAIIAKHLDKD 548 + +KW L V++ +T +ET+ + H+ K+ Sbjct: 1293 IHVKWPLGVRTNITYIEETSEV---HISKE 1319 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 5.7 Identities = 7/13 (53%), Positives = 10/13 (76%) Frame = -3 Query: 147 LSDSTLNHHLQHL 109 ++ TLN HL+HL Sbjct: 463 VASETLNEHLEHL 475 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,777 Number of Sequences: 336 Number of extensions: 2214 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14308417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -