BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= bmov10j07 (579 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 23 2.5 AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory recept... 23 2.5 AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory recept... 23 2.5 AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 21 5.7 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 22.6 bits (46), Expect = 2.5 Identities = 7/12 (58%), Positives = 8/12 (66%) Frame = -1 Query: 486 SCCVCPCDXSYV 451 SC VC CD Y+ Sbjct: 773 SCTVCTCDAKYL 784 >AM292374-1|CAL23186.2| 659|Tribolium castaneum gustatory receptor candidate 53 protein. Length = 659 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 168 INKICPLSRIIEQCVILLHKTFTDCIVL 85 +NKIC L + + V L ++TF ++L Sbjct: 502 LNKICALHHHLSKLVKLFNETFGIVLLL 529 >AM292345-1|CAL23157.2| 384|Tribolium castaneum gustatory receptor candidate 24 protein. Length = 384 Score = 22.6 bits (46), Expect = 2.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 168 INKICPLSRIIEQCVILLHKTFTDCIVL 85 +NKIC L + + V L ++TF ++L Sbjct: 227 LNKICALHHHLSKLVKLFNETFGIVLLL 254 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 21.4 bits (43), Expect = 5.7 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +2 Query: 29 GFLLV*QIDTS*SKWRSIRSTMQSVKVLCNN 121 GF++ +DT SK+R + + + KV+ ++ Sbjct: 143 GFMIYLILDTIKSKYRQMHRLLANYKVITSD 173 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,406 Number of Sequences: 336 Number of extensions: 3156 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -